95titreadmill Console

Transcript

95TiTreadmill Console o p e rat i o n manual CORPORATE HEADQUARTERS 5100 North River Road Schiller Park, Illinois 60176 • U.S.A. 847.288.3300 • FAX: 847.288.3703 800.735.3867 (Toll-free within U.S.A., Canada) INTERNATIONAL OFFICES LIFE FITNESS ASIA PACIFIC LTD Room 2610, Miramar Tower 132 Nathan Road Tsimshatsui, Kowloon HONG KONG Telephone: (+852) 2891.6677 FAX: (+852) 2575.6001 LIFE FITNESS ATLANTIC BV LIFE FITNESS BENELUX Bijdorpplein 25-31 2992 LB Barendrecht THE NETHERLANDS Telephone: (+31) 180.646.666 FAX: (+31) 180.646.699 LIFE FITNESS BENELUX NV Parc Industriel de Petit-Rechain 4800 Verviers BELGIUM Telephone: (+32) 87.300.942 FAX: (+32) 87.300.943 LIFE FITNESS DO BRAZIL Av. Dr. Dib Sauaia Neto 1478 Alphaville, Barueri, SP 06465-140 BRAZIL Telephone (+55) 11.4193.8282 FAX: (+55) 11.4193.8283 LIFE FITNESS AUSTRIA Vertriebs GmbH Hintschiggasse 1 1100 Vienna AUSTRIA Telephone: (+43) 1.61 57 198 FAX: (+43) 1.61 57 198.20 LIFE FITNESS EUROPE GMBH Siemensstrasse 3 85716 Unterschleissheim GERMANY Telephone: (+49) 89.31 77 51.0 FAX: (+49) 89.31 77 51.99 LIFE FITNESS ITALIA S.R.L. Via Crivellin 7/N 37010 AFFI (Verona) ITALY Telephone: (+39) 045.7237811 FAX: (+39) 045.7238197 LIFE FITNESS LATIN AMERICA and CARIBBEAN 5100 North River Road Schiller Park, Illinois 60176 U.S.A. Telephone: (+1) 847.288.3300 FAX:(+1) 847.288.3702 LIFE FITNESS UK LTD Queen Adelaide Ely, Cambs CB7 4UB UNITED KINGDOM Telephone: (+44) 1.353.666 017 FAX: (+44) 1.353.666 018 LIFE FITNESS JAPAN Nippon Brunswick Bldg., #8F 5-27-7 Sendagaya Shibuya-Ku, Tokyo Japan 151-0051 Telephone: (+81) 3.3359.4309 FAX: (+81) 3.3359.4307 LIFE FITNESS IBERIA Pol. Ind. Molí dels Frares. c/C, nº 12 08620 Sant Vicenç dels Horts (Barcelona) España Telephone: (+34) 93.672.4660 FAX: (+34) 93.672.4670 M051-00K70-A003 10/07 Before using this product, it is essential to read this ENTIRE operation manual and ALL installation instructions. It describes equipment setup and instructs members on how to use it correctly and safely. Avant d'utiliser ce produit, il est indispensable de lire ce manuel d'utilisation dans son INTÉGRALITÉ, ainsi que TOUTES les instructions d'installations. Ce manuel explique comment installer l'équipement et comment l'utiliser correctement et sans danger. FCC Warning - Possible Radio / Television Interference NOTE: This equipment has been tested and found to comply with the limits for a Class A digital device, pursuant to part 15 of the FCC rules. These limits are designed to provide reasonable protection against harmful interference when the equipment is operated in a commercial environment. This equipment generates, uses and can radiate radio frequency energy, and if not installed and used in accordance with the instruction manual, may cause harmful interference to radio communications. Operation of this equipment in a residential area is likely to cause harmful interference in which case the user will be required to correct the interference at his own expense. Class SB (Studio): Professional and / or commercial use. CAUTION: Any changes or modifications to this equipment could void the product warranty. Mise en garde : tout changement ou toute modification de ce matériel peut annuler la garantie du produit. Any service, other than cleaning or user maintenance, must be performed by an authorized service representative. There are no user serviceable parts. 1 TABLE OF Section 1. 1.1 2. 2.1 2.2 2.3 Description Page Getting Started . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4 Important Safety Instructions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4 The Display Console and Activity Zone . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .6 Display Console and Activity Zone Overview . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .6 Display Console and Activity Zone Descriptions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .7 Reading Rack, Accessory Trays and Media Holder . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .15 3. 3.1 3.2 4. 4.1 4.2 4.3 4.4 4.5 5. 5.1 5.2 5.3 5.4 5.5 CONTENTS Heart Rate Zone Training® Exercise . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .16 Why Heart Rate Zone Training Exercise ? . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .16 Heart Rate Monitoring . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .17 The LifepulseTM System // The Optional Heart Rate Chest Strap The Workouts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .18 Workout Overviews . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .18 Using the Workouts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .20 Beginning a Workout // Selecting a Workout // Entering Workout Goals // Entering Workout Values // Using Marathon Mode // Changing/Ending A Workout Workout Hierarchy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .24 Workout Descriptions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .26 Quick Start // Classic: Manual, Random, Hill // Heart Rate +: Fat Burn, Cardio, Heart Rate HillTM, Heart Rate IntervalTM, Extreme Heart RateTM // Hill +: Around the World, Cascades, Foothills, Kilimanjaro // Advanced Workouts: Fit Tests (Life Fitness, Army PFT, Navy PRT, Marines PFT, Air Force PRT, Gerkin Protocol, Physical Efficiency Battery) // Sport Training TM: Sport Training (5K), Sport TrainingTM (10K), Speed Training, Speed Interval // Create Your Own (Speed Interval and Heart Rate Interval) Workout LandscapeM Perspectives . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .33 Maximizing Workouts on a Life Fitness Treadmill . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .34 Selecting a Level // Cool Down Additional Features . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .34 Audio Cues // iPod® Compatibility// Virtual Trainer // USB Connectivity // Zoom Feature // Media Center Systems Options Menu . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .36 Using the System Options Menu . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .36 Configuration Menu . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37 Manager’s Configuration 1 Language // Units // Workout Duration Configuration // Standby Configuration Manager’s Configuration 2 Acceleration and Deceleration Rates // Custom Message // Program Timeout // Create Your Own Manager Configuration // Fit Tests // Marathon Mode // Audio Cues Manager Configuration Touch Screen Configuration Export / Import Settings Configuration Settings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .39 95 Ti Console Specifications . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .40 Warranty Information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .41 © 2007 Life Fitness, a division of Brunswick Corporation. All rights reserved. Life Fitness, FlexDeck, and Heart Rate Zone Training are registered trademarks, and Go System, Sport Training, Heart Rate Hill, Heart Rate Interval, Extreme Heart Rate, Lifepulse and Lifespring are trademarks of Brunswick Corporation. Polar is a registered trademark of Polar Electro, Inc. Fitlinxx is a registered trademark of the Integrated Fitness Corp. Any use of these trademarks, without the express written consent of Life Fitness or the corresponding companies is forbidden. 2 This Operation Manual describes the functions of the following product:: Life Fitness Treadmill: 95Ti See "Specifications" in this manual for product specific features. Statement of Purpose: The treadmill is an exercise machine that enables users to walk or run, in place, on a moving surface. Health-related injuries may result from incorrect or excessive use of exercise equipment. Life Fitness STRONGLY recommends seeing a physician for a complete medical exam before undertaking an exercise program, particularly if the user has a family history of high blood pressure or heart disease, or is over the age of 45, or smokes, has high cholesterol, is obese, or has not exercised regularly in the past year. If, at any time while exercising, the user experiences faintness, dizziness, pain, or shortness of breath, he or she must stop immediately. Des problèmes de santé peuvent être causés par une utilisation incorrecte ou excessive de l'équipement. Life Fitness recommande FORTEMENT de consulter un médecin pour subir un examen médical complet avant de commencer tout programme d'exercice, et tout particulièrement si l'utilisateur a des antécédents familiaux d'hypertension ou de troubles cardiaques, s'il a plus de 45 ans, s'il fume, s'il a du cholestérol, s'il est obèse ou n'a pas fait d'exercice régulièrement depuis un an. Si, pendant l'utilisation de l'appareil, l'utilisateur ressent un malaise, des vertiges, des douleurs ou des difficultés à respirer, il doit s'arrêter immédiatement. 3 1 1.1 GETTING STARTED IMPORTANT SAFETY INSTRUCTIONS Read all instructions before using the treadmill. OPERATION • Always follow the console instructions for proper operation. • Never insert objects into any opening in this product. If an object should drop inside, turn off the power, unplug the power cord from the outlet, and carefully retrieve it. If the item cannot be reached, contact Life Fitness Customer Support Services. • Do not reach into, or underneath, the unit or tip it on its side during operation. • Never place liquids of any type directly on the unit, except in an accessory tray or holder. Containers with lids are recommended. • Do not use this product in bare feet. Always wear shoes. Wear shoes with rubber or high-traction soles. Do not use shoes with heels, leather soles, cleats or spikes. Make sure no stones are embedded in the soles. • Keep all loose clothing, shoelaces, and towels away from moving parts. • Handrails may be held to enhance stability as needed, but are not for continuous use. • Never mount or dismount the treadmill while the running belt is moving. Use the handrails whenever additional stability is required. In case of an emergency, such as tripping, grasp the handrails, and place the feet on the side platforms. • Never walk or jog backwards on the treadmill. • The system issues immobilization of the treadmill when a pre-defined hard key sequence has been activated by the club manager. This sequence is currently defined as 3 STOP key presses followed by 3 SPEED DOWN ARROW key presses. To prevent false toggling of the Immobilized feature, this sequence should be limited to a pre-defined time period (i.e. sequence must be done in a 5-10 second period). Sequence should also enforce that only PRESSED events are used (i.e. if HELD or RELEASED are detected during the sequence, then the sequence is rejected). Once the Workout Logic sees this event, it toggles the Immobilization configuration item, saves it in the registry, and then issues an ImmobilizationStatus event to the system. SAVE THESE INSTRUCTIONS FOR FUTURE REFERENCE. 4 1 DÉMARRAGE 1.1 CONSIGNES DE SÉCURITÉ IMPORTANTES Lire toutes les instructions avant d'utiliser le tapis roulant. FONCTIONNEMENT • Ne jamais placer aucun liquide directement sur l'appareil, sauf dans le plateau pour accessoires ou un support prévu à cet effet. Il est recommandé d'utiliser des contenants munis de couvercles. • Éloigner les vêtements lâches, les lacets et les serviettes des pièces en mouvement. • Les rampes latérales peuvent servir à rétablir son équilibre, mais ne sont pas destinées à un usage continu. • Ne jamais monter sur le tapis de course et ne jamais en descendre pendant qu'il tourne. Utiliser les rampes latérales afin de ne pas perdre l'équilibre. En cas d'urgence, par exemple, en cas de trébuchement ou de faux pas, saisir les barres latérales et placer les pieds sur les plates-formes latérales. • Ne jamais marcher ni courir à reculons sur le tapis roulant. • Quand il est nécessaire d'immobiliser le tapis roulant, retourner à l'écran de bienvenue. (Appuyer deux fois sur la touche STOP ramène immédiatement l'appareil à l'écran de bienvenue.) Tenir brièvement la touche SPEED DOWN (ralentir), la relâcher et appuyer sur la touche PAUSE. (La touche VITESSE VERS LE BAS est la flèche pointant vers le bas à l'extrême droite du groupe de flèches sur le panneau de commande.) L'écran du tapis roulant affiche alors «Appareil immobilisé par le gestionnaire» Il ne peut alors plus fonctionner, Le moteur principal, et la la pente. Le tapis roulant restera immobilisé, même s'il est réinitialisé, mis hors tension, puis remis sous tension, etc. Le mode de fonctionnement normal ne peut être rétabli qu'au moyen de la même séquence de touches : tenir brièvement la touche VITESSE VERS LE BAS enfoncée, la relâcher et appuyer sur la touche PAUSE. Le tapis roulant reviendra à l'écran de bienvenue. CONSERVER CES INSTRUCTIONS POUR LE CONSULTER À L'AVENIR. 5 2 THE DISPLAY CONSOLE AND ACTIVITY ZONE 2.1 DISPLAY CONSOLE AND ACTIVITY ZONE OVERVIEW The computerized display console on the treadmill allows the user to tailor a workout to personal fitness abilities and goals and to monitor progress. With this easy-to-use console, the user can track fitness improvement from one workout to the next. a. Touchscreen Display: The Touchscreen Display (the LCD screen) allows the user to choose, set up, and monitor a workout. b. Activity Zone: The Activity Zone allows the user to quickly adjust the incline and speed during a workout using the UP and DOWN arrows. The Activity Zone also includes a QUICK START button, and WALK, JOG, and RUN preset buttons. A STOP button is located on top of the Activity Zone. A STOP magnet is located on the bottom of the Activity Zone. c. Options Panel: The Options Panel allows the user to plug in headphones, iPod®, or USB stick. d. Control Panel: The Control Panel allows the user to control workout and media parameters without leaving the Workout Progress screen by pressing illuminated keys. e. Data Display: The Data Display allows the user to view distance, heart rate, and calories burned during the workout. 6 2.2 DISPLAY CONSOLE AND ACTIVITY ZONE DESCRIPTIONS This section lists and describes the functions for the buttons on the Touchscreen Display on the Life Fitness Treadmill. See Section 4, The Workouts, for detailed information on using the console to set up workouts. TOUCHSCREEN DISPLAY The Touchscreen Display, in combination with the illuminated Control Panel keys, allows the user to move from screen to screen by simply touching buttons to access other screens. Among many features, the Touchscreen Display enables users to access: 1) SELECT WORKOUT — choose a workout. 2) VIRTUAL TRAINER SETUP — choose a Virtual Trainer for workout motivation. 3) USB PRESET SELECTION — select a saved preset from a USB stick. 4) WORKOUT SETUP — enter workout values and goals. 5) WORKOUT PROGRESS —monitor progress, edit workout goals, and access entertainment. 6) WORKOUT SUMMARY INFORMATION — view and save workout summary information. 7) MEDIA CENTER — setup media options (Life Fitness ATTACHABLE TV and iPod). 8) LANGUAGE SELECT — choose from various available languages. 1) HOME SCREEN A. QUICK START: Press this button to begin a manual workout immediately, bypassing any setup or goal setting. Once started, the user can then make adjustments to the workout. Once the workout is in progress choose SPEED, or INCLINE to determine the level of intensity, and ENTER WEIGHT FOR ACCURATE CALORIES so that Calories Burned/Calories per Hour can be computed and displayed. Select the COOL DOWN button on the bottom of the screen to enter a cool down phase when ready. B. SELECT WORKOUT: Allows the user to choose from up to twenty-eight different workout programs. See Section 4.1,Workout Overviews, for a description of each workout. C. VIRTUAL TRAINER: Allows the user to select a male or female trainer to assist during workout setup and provide audible feedback during a workout. D. USB: Allows the user to access previously saved workout setup data, bypassing the workout setup procedure and immediately entering a workout. E. SCREEN LOCK/UNLOCK: (Cannot be used during a workout.) Freezes the screen for the purpose of routine maintenance/screen cleaning. The screen automatically unlocks after ten seconds. Pressing SCREEN LOCK a second time will unlock it as well. 7 F. LANGUAGE SELECTION: Allows users to change the language of the interface to one of thirteen possible languages. Select the appropriate language flag from the bottom of the screen. G. MORE LANGUAGES: Select this button to see additional language flags. See Section 5.2, Configuration Menu, Manager’s Configuration 1, Language, for language setup details. 2) CONTROL PANEL The Control Panel allows the user to control workout and media parameters without leaving the Workout Progress screen. H. ARROW KEYS: When in the workout phase, the illuminated UP and DOWN arrow keys are used in combination with the Touchscreen Display. These keys allow the user to make changes to a workout goal during the workout setup. Each set of arrow keys controls the goal located directly above it on the Touchscreen Display. Changeable information (i.e. a workout goal) either appears as a button (Time, Level, Incline, Target Heart Rate*, and Speed) or is accessible through CHANGE WORKOUT, CHANGE GOAL (Calories, Distance, and for heart rate programs, Time in Zone). Workout statistics are not changeable. For example, use the illuminated arrow keys under ELAPSED TIME (a workout goal) to change the goal time for the session. I. COOL DOWN: Workout programs end automatically in a cool down phase, which lowers the intensity level. In this phase of a workout the body begins to remove lactic acid and other accumulated by-products of exercise, which build up in muscles during a workout and contribute to muscle soreness. Press the illuminated key under COOL DOWN to enter the cool down stage at any point during the workout. Each workout’s cool down level is automatically adjusted according to the individual user’s performance. (Cool down times are preset in proportion to the duration of a workout.) The cool down time can be changed by using the corresponding arrow keys on the control panel. At the end of cool down, or after pressing the END WORKOUT key, a workout summary box appears. J. PAUSE: Press the illuminated key below PAUSE to stop the belt and hold the current workout. A RESUME WORKOUT button and EXIT button appear on the Touchscreen. Continue the workout by selecting RESUME WORKOUT or end the workout by selecting EXIT. K. MEDIA: Press the illuminated key next to MEDIA to access the following options: Life Fitness Attachable Television and iPod. L. VOLUME: Volume control for the optional Life Fitness Attachable TV and iPod. Press the illuminated UP and DOWN arrow keys next to the volume icon to adjust volume. * Target Heart Rate (THR) is a percentage of the theoretical maximum. For example, a 40-year-old user's THR for the FAT BURN workout is 117. This workout targets 65 percent of the maximum, so the equation would be (220-40)*.65=117. 8 M. CH: Channel control for the optional Life Fitness Attachable TV and iPod. Press the illuminated UP and DOWN arrow keys next to the channel icon (ch) to change channel. N. CHANGE VIEW: Press the illuminated key next to CHANGE VIEW to toggle between four landscapes: 400-METER TRACK, CLASSIC PROFILE, MOUNTAIN, and 5K NATURE TRAIL. O. CHANGE WORKOUT: Press the illuminated key next to CHANGE WORKOUT to switch between four categories of workouts. P. VIRTUAL TRAINER: Press the illuminated key next to VIRTUAL TRAINER to turn trainer off. NOTE: Headphones are necessary to access the sound for the optional Life Fitness Attachable TV and iPod. The headphone jack is located on the lower center of the Activity Zone. The jack is a user-replaceable feature. Contact Life Fitness Customer Support Services for more information. (See Base Assembly Manual for contact information.) 3) WORKOUT SETUP Workouts are accessed through the SELECT WORKOUT button. Workouts are located under one of four workout categories: CLASSIC, HEART RATE +, HILL + and ADVANCED. Workout options are listed to the right of each category label. Advancing through the categories will show individual workout descriptions. WORKOUT SETUP screens are accessed upon selection of a workout program button. They allow the user to enter values or to choose a goal for the workout selected. These depend on the workout, but might include goal type (time, distance, calories, pace, and distance climbed), level, age, weight, distance, speed, incline, and target heart rate* (for heart rate programs). A1. DATA DISPLAY: Displays the data input and value. B1. ARROW BUTTONS: Use the UP and DOWN arrows to adjust workout values/goals such as length of workout, weight, age, incline, speed, distance, target heart rate, and intensity level. Press ENTER (E1) to record the selection. C1. NUMERIC KEYPAD: Another way for the user to enter workout parameters. Key in the desired number on the keypad and press ENTER (E1). D1. CLEAR: Clears any entry and returns the default setting. E1. ENTER: Press this button after entering a value to register the value and move to the next screen. * Target Heart Rate (THR) is a percentage of the theoretical maximum. For example, a 40-year-old user's THR for the FAT BURN workout is 117. This workout targets 65 percent of the maximum, so the equation would be (220-40)*.65=117. 9 F1. GOAL TYPE: Select a desired workout goal type. Choose from Time, Distance, Calories, Pace, Distance Climbed, Time in Zone or Marathon Mode (if enabled). G1. BACK: Returns to the previous screen. H1. START OVER: Exits workout setup and returns to the Home Screen. TYPES OF WORKOUT SETUP SCREENS GOAL SETUP SCREENS • Goal Type: The default setting of Goal Type is TIME (length of workout) allowing the user to set a predetermined length of time for the workout. Users may also choose a more advanced Goal Type such as DISTANCE, CALORIES, PACE, DISTANCE CLIMBED, or TIME IN ZONE (only available for heart rate programs). For Distance, Calories, Pace, Distance Climbed, and Time in Zone, the length of the workout depends on how long it takes to reach the goal. The workout continues until the goal is met. To exit early, either choose COOL DOWN from the bottom of the display to go immediately into the cool down phase, or choose CHANGE WORKOUT to access a different program. For more information, see Section 4.2, Using the Workouts, Selecting a Goal Type. For information on how to set, and get maximum benefit from, these type of workout goals consult a Personal Trainer. For further information on Zone Training see Section 3.1, Heart Rate Zone Training, titled Why Heart Rate ZoneTraining Exercise. • Level: Choose the programmed intensity level of the workout. Levels range from 1 to 20. • Incline: Choose the amount of incline on the treadmill. • Speed: Use to set the striding belt speed of the treadmill. • Target Heart Rate*: (heart rate workouts only) Gives a recommended heart rate according to age. For Fat Burn, the target heart rate is computed at 65% of the theoretical maximum† heart rate. For Cardio, the target heart rate is computed at 80%. For more information on Target Heart Rate, see Section 3, Heart Rate Zone Training Exercise. VALUE SETUP SCREENS † • Weight: Entering an accurate weight allows calories to be calculated, and enables Calories Burned and Calories per Hour to appear on the Workout screen. • Age: Allows heart rate programs to accurately determine target heart rate. • Gender: For accurate Fitness Testing. Defined by the American College of Sports Medicine's "Guidelines for Exercise Testing and Prescription" as equal to 220 minus an individual’s age. * Target Heart Rate (THR) is a percentage of the theoretical maximum. For example, a 40-year-old user's THR for the FAT BURN workout is 117. This workout targets 65 percent of the maximum, so the equation would be (220-40)*.65=117. 10 4) WORKOUT PROGRESS The Workout Progress Screen opens automatically upon completion of the workout setup, signaling the user to start the workout. This screen allows the user to monitor the progress of the workout. It provides a visual representation of the workout as it proceeds and monitors distance, pace, elapsed time, heart rate, incline, speed, and calories expended/calories per hour. From the Workout Progress Screen, goals including Time, Incline, Speed and Target Heart Rate* (for heart rate programs) can be changed at any point during the workout. Not every goal item is available in every workout. Only valid goal times are shown and accessible in the workout progress screen during a workout. This screen also allows access to the media center. A2. MESSAGE AREA: Shows the user the workout type, prompts the user for needed information, and explains concepts. B2. WORKOUT PROFILE WINDOW: This window displays workout progress using one of four workout landscapes. C2. CHANGE VIEW: This button allows the user to toggle between four workout landscapes: 400-METER TRACK, CLASSIC PROFILE, MOUNTAIN, and 5K NATURE TRAIL. These can be toggled between at will without losing workout progress information. D2. CHANGE WORKOUT: Choose this button to go back to the workout selection screen and SELECT WORKOUT. To change workouts, choose the new program, enter any remaining values, and press ENTER. E2. VIRTUAL TRAINER: Choose this button to enable or disable the VIRTUAL TRAINER. F2. GOAL DISPLAYS HEART RATE: (Replaces level on heart rate workouts only.) Displays the target heart rate* the user has specified in the workout setup screens. Can be changed anytime during a workout, by touching the HEART RATE button on the Touchscreen, and accessing the Target Heart Rate Workout Setup Screen. ACTUAL HEART RATE: Displays the heart rate if the user grasps the Lifepulse sensors or wears a Polar-compatible heart rate chest strap. NOTE: Heart rate can be checked on any of the screens, whether before a workout begins, or during a workout. DISTANCE: Displays the accumulated distance traveled or distance climbed during a workout. CALORIES/CALORIES PER HOUR/PACE: Displays the accumulated calories burned, calories burned per hour, and the striding pace. G2. % INCLINE: Press this button to increase or decrease the incline of the treadmill deck. Use the illuminated ARROW KEYS on the Control Panel directly below % INCLINE to make changes without leaving the Workout Progress Screen. * Target Heart Rate (THR) is a percentage of the theoretical maximum. For example, a 40-year-old user's THR for the FAT BURN workout is 117. This workout targets 65 percent of the maximum, so the equation would be (220-40)*.65=117. 11 H2. SPEED: Press this button to increase or decrease the striding belt speed. Use the illuminated ARROW KEYS on the Control Panel directly below SPEED to make changes without leaving the Workout Progress Screen. I2. WORKOUT STATISTICS: Continually updates workout progress by showing Distance, Pace in minutes per mile/kilometer, Calories Expended/Calories per Hour, Target Heart Rate (for heart rate programs), Heart Rate (on any workout if the user is grasping the Lifepulse sensors or wearing a telemetry strap), and Time in Zone (if selected as a workout goal). Cal/Hr has a button above the display which give added functionality. This button can be used to lock the display or to force the display to toggle. To lock the display, (for instance, turn off the toggle so only calories burned is displayed) simply press the button once while the desired setting is displayed. To toggle press the button twice in succession. J2. ZOOM: Select this button to view Incline, Time and Speed in a large, easy-to-read display. The workout profile is not viewable while ZOOM mode is active. K2. TIME DISPLAY/ELAPSED TIME: Select this button to view the time of day, change the length of the workout, or to choose a different view for time. To change workout length, select ELAPSED TIME, use the arrow buttons or the numerical keypad to adjust the time, and then select ENTER. To change the time view, select ELAPSED TIME, choose a different time view (REMAINING TIME or HIDDEN TIME) and press ENTER. To change the length of a workout without leaving the Workout Progress Screen, use the illuminated ARROW KEYS on the Control Panel directly underneath ELAPSED TIME. NOTE: Changing the length of a workout by using the TIME ELAPSED button has no effect on the time elapsed, which is an ongoing measurement of the time already spent in a workout. L2. CHANNEL (ch): Channel icon for the optional Life Fitness Attachable TV and iPod. Press the illuminated ARROW KEYS next to the channel icon (ch) to change channel. M2. VOLUME: Volume icon for the optional Life Fitness TV and iPod. Press the illuminated ARROW KEYS next to this icon to adjust volume. N2. COOL DOWN: Workout programs end automatically in a cool down phase, which lowers the intensity level. In this phase of a workout the body begins to remove lactic acid and other accumulated by-products of exercise, which build up in muscles during a workout and contribute to muscle soreness. Press the COOL DOWN key to enter the cool down stage at any point during the workout. Each workout’s cool down level is automatically adjusted according to the individual user’s performance. (Cool down times are preset in proportion to the duration of a workout.) The cool down time can be changed by using the corresponding arrow keys on the Control Panel. At the end of cool down, a workout summary box appears. O2. PAUSE: Press this key to stop the belt and hold the current workout. A RESUME WORKOUT button and EXIT button appear on the Touchscreen. Continue the workout by selecting RESUME WORKOUT or end the workout by selecting EXIT. P2. MEDIA: Press the MEDIA button to access the following options: Life Fitness Attachable TV and iPod. Users can access the following TV viewing options: CHANNEL CONTROLS: Use the illuminated UP and DOWN ARROW KEYS on the control panel that are next to the channel select icon on the control panel to change channels. NUMERIC KEYPAD: Use to enter a new channel selection. PREVIOUS CHANNEL: Select this button to change the channel to the immediately previous channel viewed. CC (CLOSED CAPTIONING): Press to activate Closed Captioning. SAP (SECONDARY AUDIO PROGRAMMING): Press to activate Secondary Audio Programming. MUTE: Press to silence the audio of the TV. CHANNEL SELECT: Accesses the Channel Select keypad. VOLUME: Use the UP and DOWN ARROW KEYS on the control panel that are next to the volume icon on the control panel to adjust volume. 12 Users can access the following iPod options: iPod CONTROLS: If detected, use to access iPod data. Use the controls next to the menu item to navigate categories, songs, movies, etc. Press SELECT to accept the highlighted list item. HIDE PLAYLIST: Press this button to hide the iPod playlist to view the workout profile. Hiding the playlist does not turn off the iPod. Additional information appearing in the Workout Progress Screen for different workouts: ENTER WEIGHT: Appears in the Quick Start workout. Choose ENTER WEIGHT FOR ACCURATE CALORIES so Calories Burned/Calories per Hour can be computed and displayed as workout statistics. TIME IN ZONE: Displays the accumulated time that the heart rate stays within the selected target zone for a Heart Rate Zone Training workout. See Section 3, Heart Rate Zone Training Exercise, for more information. SPEED INTERVAL: (Speed Interval workout only.) Allows the user to toggle between a jog and a run speed. See Section 4.3, Workout Descriptions, Sport Training, Speed Interval. PACE DISPLAY: Allows the user to track whether his or her pace is ahead, behind or on target with his or her desired pace. 13 ACTIVITY ZONE The ErgoTM bar includes an Activity Zone which allows the user to quickly adjust the incline and speed during a workout. The Activity Zone also includes a QUICK START button, WALK, JOG and RUN preset buttons, and a STOP button. A3. INCLINE ARROW KEYS: Press these keys to increase or decrease the incline of the treadmill. B3. SPEED ARROW KEYS: Press these keys to increase or decrease the speed of the striding belt. C3. WALK, JOG, and RUN preset buttons: Press these buttons to preset a walk (2 mph), jog (4 mph), or run (6 mph) pace. D3. QUICK START: Press this key to begin a manual workout immediately without having to select a workout program. Once the workout begins, use the ARROW KEYS to change the intensity level. The Life Fitness Treadmill is equipped with a manual emergency stop system. Use either of the two features described below to stop the treadmill immediately. E3. A STOP button is located on the top of the ACTIVITY ZONE. Press the button to stop the striding belt and end the current workout. A STOP magnet is located on the bottom of the ACTIVITY ZONE. A cord with a clip is attached to this magnet. Before starting a workout, attach the clip to clothing. To stop the striding belt on the treadmill, pull the cord, removing the magnet from the ACTIVITY ZONE. Replace the magnet to reset the system. 14 2.3 READING RACK AND ACCESSORY TRAYS The display console design includes a built-in reading rack (A) allowing a book or magazine to be supported during the workout. Also included in the display console are three built-in accessory trays (B). Two side trays to accommodate large items such as water bottles and one center tray for smaller items such as personal media devices. NOTE: Since reading materials will be in front of the Touchscreen Display, use care when placing reading materials on the rack, and when turning pages, to ensure that buttons aren’t accidentally toggled. 15 3 HEART RATE ZONE TRAINING EXERCISE 3.1 WHY HEART RATE ZONE TRAINING EXERCISE? Research shows that maintaining a specific heart rate while exercising is the optimal way to monitor the intensity of a workout and to achieve maximum results. That is the idea behind the Life Fitness Heart Rate Zone Training approach to exercise. Zone Training identifies an exerciser's ideal heart rate range, or zone, for burning fat or increasing cardiovascular fitness. The zone is a percentage of the theoretical maximum† (HRmax), and its value depends on the workout. The Life Fitness Treadmill features five exclusive workouts designed to take full advantage of the benefits of Heart Rate Zone Training exercise: • FAT BURN • CARDIO • HEART RATE HILL • HEART RATE INTERVAL • EXTREME HEART RATE Each workout offers different benefits, as discussed in Section 4, The Workouts. NOTE: Consulting a fitness trainer is recommended for defining specific fitness goals and designing a workout program. The Heart Rate Zone Training workout programs measure heart rate. Wear the optional telemetry chest strap, or grip the Lifepulse sensors, to enable the treadmill’s on-board computer to monitor the heart rate during a workout. The computer automatically adjusts the incline level to maintain the target heart rate* based on the actual heart rate. To change the target heart rate during a workout, simply enter a new target heart rate by typing in the desired number on the numeric keypad or by pressing the Heart Rate button on the Touchscreen. To switch between programs during a workout, use the CHANGE WORKOUT button. † Defined by the American College of Sports Medicine's "Guidelines for Exercise Testing and Prescription" as equal to 220 minus an individual’s age. * Target Heart Rate (THR) is a percentage of the theoretical maximum. For example, a 40-year-old user's THR for the FAT BURN workout is 117. This workout targets 65 percent of the maximum, so the equation would be (220-40)*.65=117. 16 3.2 HEART RATE MONITORING THE LIFEPULSE SYSTEM To use the treadmill’s Lifepulse system to check the heart rate during a workout, grasp the stainless steel sensors on the ErgoTM front handlebar. Two sensors are located on each of the handlebars. Contact must be maintained with all four sensors to obtain a heart rate. The console displays a heart rate within 20 to 30 seconds of contact with the sensors. Do not attempt to grasp the sensors at speeds above walking pace (usually above 4.5 MPH, or 7.2 KPH). For these speeds, the use of a heart rate chest strap is recommended. THE OPTIONAL HEART RATE CHEST STRAP The Life Fitness Treadmill is equipped with Polar® telemetry, a heart rate monitoring system in which electrodes, pressed against the skin, transfer heart rate signals to the treadmill console. These electrodes are attached to a chest strap that the user wears during the workout. The chest strap is optional. To order it, call Life Fitness Customer Support Services at 1-800351-3737. See the diagram below for correct positioning of the strap. The electrodes (A), which are the two grooved surfaces on the underside of the strap, must remain wet to transmit accurately the electrical impulses of the heart back to the receiver. Moisten the electrodes. Then, secure the strap as high under the chest muscles as possible. The strap should be snug, but comfortable enough to allow for normal breathing. The transmitter strap delivers an optimal heart rate reading when the electrodes are in direct contact with bare skin. However, it functions properly through a thin layer of wet clothing. If it becomes necessary to re-moisten the chest strap electrodes, grasp the center of the strap, pull it away from the chest to expose the two electrodes, and re-moisten them. During the setup of a heart rate zone training workout, the user will be required to enter a start-up speed. If a heart rate chest strap is not detected, the maximum allowable speed is 4.5 mph. If a heart rate chest strap is detected, the maximum speed is 14 mph. A A 17 4 THE WORKOUTS 4.1 WORKOUT OVERVIEWS The following workouts are preprogrammed for the Life Fitness Treadmill. QUICK START is the fastest way to begin exercising and it bypasses the steps involved in selecting a specific workout program. After the QUICK START key is pressed, a constant level workout begins. The intensity level does not change automatically. CLASSIC workouts are workouts in which intensity levels increase and decrease in set patterns. The following workouts may be accessed with this button: MANUAL is a constant effort workout in which the user can change resistance level or speed at any time. RANDOM is an interval training workout of constantly changing intensity levels that occur in no regular pattern or progression. HILL is an interval training workout. Intervals are periods of intense aerobic exercise separated by regular periods of lower-intensity exercise. HEART RATE + workouts are workouts in which intensity levels increase and decrease in set patterns. The following workouts may be accessed with this button: FAT BURN is a low-intensity workout for burning the body’s fat reserves. The user wears a heart rate chest strap, or grasps the Lifepulse sensors continuously. The program adjusts the intensity level through changing the incline (elevation), based on the actual heart rate, to maintain the rate at 65 percent of the theoretical maximum†. CARDIO is a higher intensity workout for more fit users, emphasizing cardiovascular benefits and maximum fat burning. The user wears a heart rate chest strap, or grasps the Lifepulse sensors continuously. The program adjusts the intensity level, based on the actual heart rate, to maintain the rate at 80 percent of the theoretical maximum†. HEART RATE HILL takes the user through three different hills based on the target heart rate*. The user wears a heart rate chest strap, or grasps the Lifepulse sensors continuously. HEART RATE INTERVAL alternates between a hill and a valley based on the target heart rate*. The user wears a heart rate chest strap, or grasps the Lifepulse sensors continuously. EXTREME HEART RATE is an intense workout for more experienced users. It is designed to get the heart rate up and down as quickly as possible. The user wears a heart rate chest strap, or grasps the Lifepulse sensors continuously. HILL + are workouts in which intensity levels increase and decrease in set patterns. The following workouts may be accessed with this button: AROUND THE WORLD is an interval-training workout in which the hills resemble scenes of various geographical areas. FOOTHILLS is a rolling hill workout with low intensity levels. KILIMANJARO is a hill workout in which the intensity levels gradually incline toward one ultimate peak and then gradually decline. CASCADES is a two-peak workout in which intensity levels gradually increase and decrease. † Defined by the American College of Sports Medicine's "Guidelines for Exercise Testing and Prescription" as equal to 220 minus an individual’s age. * Target Heart Rate (THR) is a percentage of the theoretical maximum (HRmax). A 40-year-old user’s recommended THR for the HEART RATE HILL and HEART RATE INTERVAL workouts is 144, or 80 percent of the maximum; so the equation would be (220-40)*.80=144. 18 ADVANCED WORKOUTS are customized workouts designed for the advanced user not used in connection with a personal trainer. These workouts include: FIT TESTS workouts measure cardiovascular fitness and can be used to monitor improvements in endurance every four to six weeks. FIT TESTS LIFE FITNESS FIT TEST offers six different workouts to measure cardiovascular fitness compared to other people of the same age and gender. MILITARY FIT TESTS GERKIN PROTOCOL is a graded submaximal VO2 test used by the International Association of Fire Fighters to determine fitness for fire department duty. PHYSICAL EFFICIENCY BATTERY (PEB) is used by U.S. Federal Law Enforcement, and the U.S. Federal Bureau of Investigation, and other federal organizations for the hiring and maintenance of federal jobs. ARMY PHYSICAL FITNESS TEST (PFT) is a 2.0 mile physical performance test used to assess muscular endurance and cardiorespiratory fitness. NAVY PHYSICAL READINESS TEST (PRT) is the running portion of the Navy PFT. It is a 1.5 mile distance goal test, based on the time needed to complete the required distance, and is used by the U.S. Navy and Naval academies to measure aerobic capacity. AIR FORCE PHYSICAL READINESS TEST (PRT) is a 1.5 mile physical performance test used to assess muscular endurance and cardiorespiratory fitness. MARINES PHYSICAL FITNESS TEST (PFT) is a 3.0 mile physical performance test used to assess muscular endurance and cardiorespiratory fitness. CREATE YOUR OWN CREATE YOUR OWN workouts enable the user to design personalized workouts based on SPEED INTERVAL or on HEART RATE INTERVAL. SPORT TRAINING SPORT TRAINING (5K) is a distance-goal workout that simulates an actual terrain with varying incline levels. It is designed to assist runners in training for a 5-kilometer, or 3.1-mile, race. SPORT TRAINING (10K) is a distance-goal workout that simulates an actual terrain with varying incline levels. It is designed to assist runners in training for a 10-kilometer, or 6.2-mile, race. SPEED TRAINING is a Hill workout in which the intensity level alternates between high and low levels very quickly to simulate a typical speed-training workout. SPEED INTERVAL allows the user to toggle between user defined jog and run speeds. The user can toggle the speeds at any time during the workout, or adjust the speeds “on the fly.” 19 4.2 USING THE WORKOUTS Select a workout. See the chart at the beginning of Section 4.3 for an overview of the steps required to set up each workout. 1) BEGINNING A WORKOUT There are three ways to being a workout: Quick Start, Select Workout (see Section 4.22) and Virtual Trainer (see Section 4.5). SELECTING AND USING QUICK START QUICK START is the fastest way to begin exercising. It bypasses the steps of selecting a specific workout program. On the home screen, press the QUICK START button. The workout begins at an intensity level that remains the same unless manually changed. Choose ENTER WEIGHT FOR ACCURATE CALORIES so that Calories Burned/Calories per Hour can be computed and displayed as workout statistics. 2) SELECTING A WORKOUT Press the SELECT WORKOUT button to begin the workout selection process. The touchscreen will bring up the top level workout categories which include CLASSIC, HEART RATE+, HILL +, and ADVANCED. Each workout button includes a listing of workout programs or an easy to understand description of the workout. Once a workout is selected, the corresponding Workout Setup Screens which include goal type (time, distance, calories, pace, and distance climbed), level, age, weight, distance, speed, incline, and target heart rate* will appear. Press ENTER after each selection to record it. After values are set, the Workout Progress Screen appears and the workout begins. See Section 4.3 for detailed information on available workouts. 3) ENTERING WORKOUT GOALS SELECTING A GOAL TYPE Goal Type defaults to TIME (length of workout.) When prompted to enter a Goal Time, use the illuminated ARROW KEYS to increase or decrease the displayed time to the desired value, or key in the desired value with the NUMERIC KEYPAD, and press ENTER. Workouts can be programmed to target advanced goals other than the default time goal: • DISTANCE • CALORIES • PACE • DISTANCE CLIMBED • TIME IN ZONE (for heart rate workouts only) The Distance Goal feature is designed to build endurance. The user sets a distance goal during the workout setup. Once the goal is met, the workout automatically goes into a cool down phase and ends afterward. To use this feature: 1. Select a workout. 2. In the Goal Type setup screen, choose DISTANCE, enter the desired distance goal, and select ENTER. 3. Finish the setup steps for the selected workout. 4. Begin the workout. The Calories Goal feature is designed to promote weight loss and weight control. The user sets a calorie goal during the workout setup. Once the goal is met, the workout automatically goes into a cool down phase and ends afterward. To use this feature: 1. Select a workout. 2. In the Goal Time setup screen, choose CALORIES, enter the desired calorie goal, and select ENTER. 3. Finish the setup steps for the selected workout. 4. Begin the workout. * Target Heart Rate (THR) is a percentage of the theoretical maximum. For example, a 40-year-old user's THR for the FAT BURN workout is 117. This workout targets 65 percent of the maximum, so the equation would be (220-40)*.65=117 20 The Pace Goal feature is designed to allow the user to set the pace of a workout. The user sets a pace goal during the workout setup. Once the goal is met, the workout automatically goes into a cool down phase and ends afterward. A pace readout is displayed at the left of the screen showing numeric feedback regarding the user’s progress relating to the selected pace. To use this feature: 1. Select a workout. 2. In the Goal Time setup screen, choose MORE, select PACE, enter the desired pace goal, and select ENTER. 3. For Units, choose either ENGLISH (to set a pace speed in miles/time) or METRIC (to set a pace speed in kilometers/time). 4. Enter the distance and time of the workout. 5. The console will calculate the pace the user must maintain to finish the workout in the desired time. 6. Select ENTER to approve the displayed pace or reenter the chosen time and distance. 7. Begin the workout. The Distance Climbed Goal feature is designed to allow the user to set a distance climbed of a workout. The user sets a distance climbed goal during workout setup. Once the goal is met, the workout automatically goes into a cool down phase and ends afterward. To use this feature: 1. Select a workout. 2. In the Goal Time setup screen, choose MORE, select DISTANCE CLIMBED, enter the desired distance climbed goal, and select ENTER. 3. Finish the setup steps for the selected workout. 4. Begin the workout. The Time in Zone Goal program enhances a workout by setting a certain duration within the target heart rate* as a workout goal. The program automatically alters the resistance to maintain a pace that will meet that objective within that duration. Once the objective is met, the workout automatically goes into a cool down phase. To use the Time In Zone Goal feature: 1. Select a workout. 2. In the Goal Time setup screen, choose TIME IN ZONE (some workouts require the user to choose the MORE option first), enter the desired amount of time, and select ENTER. 3. Finish the setup steps for the selected workout. 4. Begin the workout. NOTE: Time in Zone is directly correlated to fitness level. Since the program will continue to increase resistance until the goal is met, it may be wise to start low and work towards a higher goal. Choose COOL DOWN at any time, to exit the workout and immediately enter a cool down phase. For help setting TIME IN ZONE goals, consult a personal trainer. For more information on Heart Rate Zone Training, see Section 3.1, Why Heart Rate Zone Training? INTENSITY LEVEL The Life Fitness Treadmill provides several different ways to adjust the intensity level of an workout. Press the INCLINE button on the Workout Progress Screen to use the NUMERIC KEYPAD to enter the desired level and the press ENTER. Adjust the level as needed or desired during the workout by pressing the illuminated ARROW KEYS on the Control Panel under the INCLINE button. Intensity level: The Life Fitness Treadmill provides a selection of 20 intensity levels. Each level represents a range of incline percentages. (See Section 4.4 Maximizing Workouts on a Life Fitness Treadmill for a chart showing all 20 levels.) The Workout Profile Window displays the levels of intensity in a workout-in-progress as proportional columns. The height of the column furthest to the left is proportional to the current level of intensity. Selecting a low intensity level at first is recommended. As physical conditioning improves, the levels can increase. * Target Heart Rate (THR) is a percentage of the theoretical maximum. For example, a 40-year-old user's THR for the FAT BURN workout is 117. This workout targets 65 percent of the maximum, so the equation would be (220-40)*.65=117 21 TARGET HEART RATE Target heart rate: Programs that calculate a target heart rate* base this number on the age of the user and the type of workout. The user accepts or adjusts the rate when setting up the workout. During the workout itself, the program reads the heart rate, which is transmitted via the Polar heart rate chest strap or the Lifepulse system sensors; and it uses this data to adjust the resistance. Manually raising the rate, by pressing the HEART RATE button on the CONTROL PANEL and typing the desired number with the NUMERIC KEYPAD, increases the intensity of the cardiovascular exercise. 4) ENTERING WORKOUT VALUES AGE: When prompted to enter Age, use the illuminated ARROW KEYS to increase or decrease the displayed age to the correct value, or key in the correct value with the NUMERIC KEYPAD, and press ENTER. Life Fitness Treadmill workout programs that set a target heart rate* zone first calculate the user’s theoretical maximum heart rate† by subtracting the user’s age from the number 220. The programs then calculate the target zone as a percentage of the theoretical maximum. WEIGHT: Select weight and press ENTER. Entering an accurate weight allows for a more accurate calorie calculation. GENDER: Select gender and press enter. (Used for the Fitness Testing workouts.) 5) USING MARATHON MODE If Marathon Mode is enabled, a Marathon Mode button will appear in the time entry screen when configuring a workout. Selecting Marathon Mode sets the workout to an unlimited time workout. The workout can then be ended only by the user or one of the emergency stop systems. Within a workout, Marathon Mode can be changed by pressing the Time Key. Pressing the Time Key makes it possible to set a time goal as long as it's not less than the time already spent in the workout. A new time goal must be set and entered to override Marathon Mode 6) CHANGING/ENDING A WORKOUT SWITCHING WORKOUTS “ON-THE-FLY” It is possible during a workout, to switch to another workout program. After a switch, the console retains all the progress information about the workout since its beginning. To change workouts “on the fly,” simply press CHANGE WORKOUT and then choose a new workout. To switch to a new workout, and restart the progress information, choose CHANGE WORKOUT and then RESET. PAUSING WORKOUTS Press the PAUSE key to stop the belt and hold the current workout. A RESUME WORKOUT button and EXIT button appear on the Touchscreen. Continue the workout by selecting RESUME WORKOUT or end the workout by selecting EXIT. The pause duration defaults to 1 minute (configurable by the manager), after which, the console returns to the Home Screen. A workout can also be paused by using ZEROUT speed control. If, during a workout, a user decreases the speed to the minimum and continues to hold the DECREASE SPEED ARROW, the speed falls to 0 (zero) MPH, which is pause mode. The minimum speed is 0.5 MPH, unless changed in the Manager’s Configuration. See section 5.3, Manager’s Configuration Setting 1, for more information. † Defined by the American College of Sports Medicine's "Guidelines for Exercise Testing and Prescription" as equal to 220 minus an individual’s age. * Target Heart Rate (THR) is a percentage of the theoretical maximum. For example, a 40-year-old user's THR for the FAT BURN workout is 117. This workout targets 65 percent of the maximum, so the equation would be (220-40)*.65=117 22 ENDING WORKOUTS EARLY To end a workout early, press COOL DOWN on the Control Panel. The COOL DOWN button changes into an END WORKOUT button. A user can stop a workout by pushing the END WORKOUT button; otherwise the cool down phase will automatically begin. The program will designate a cool down time period in proportion to the amount of time spent in the workout. Upon completion of cool down, a workout summary will appear, which includes the distance travelled, the total calories burned, average heart rate, average pace, and elapsed time. To exit the workout without a cool down, press the STOP button or select CHANGE WORKOUT, and then RESET. WORKOUT SUMMARY Upon ending a workout, a workout summary will appear. The following information is displayed: Average Speed, Distance, Calories Burned, Average Heart Rate, and Elapsed Time. Users have the following three options regarding the workout summary: save the data to a USB stick for preset workouts and workout tracking by SELECTING USB; leave the workout summary by selecting EXIT; or increase the time the summary is shown on screen by selecting MORE TIME. The duration of the Workout Summary screen defaults to one minute. 23 4.3 WORKOUT DESCRIPTIONS WORKOUT HIERARCHY Select Workout Classic 24 Heart Rate + Hill + Manual Fat Burn and Cardio Around the World Random Heart Rate Hill Cascades Hill Heart Rate Interval Foothills Extreme Heart Rate Kilimanjaro Advanced Fit Tests Life Fitness Fit Test Army PFT Military Navy PRT Gerkin Air Force PRT PEB Marines PFT Create Your Own / Custom CYO Speed Interval Sport Training Custom 1 Sport Training 5K Custom 2 Custom 3 CYO Heart Rate Interval Custom Speed Interval Sport Training 10K Custom 4 Custom 1 Speed Training Custom 2 Custom 3 Custom Heart Rate Interval Speed Interval Custom 4 25 WORKOUT DESCRIPTIONS QUICK START QUICK START is the fastest way to begin exercising, and it bypasses the specific steps of selecting a specific workout program. After the QUICK START button (Touchscreen Display) or key (Activity Zone) is pressed, a MANUAL workout begins. For Calories Burned/Calories per Hour to be computed and displayed during a workout, select the ENTER WEIGHT FOR ACCURATE CALORIES button which is required to calculate these values. The speed is set to the minimum level. To change the speed and stay in the Workout Progress Screen, press the illuminated ARROW KEYS on the Control Panel, corresponding to the SPEED button. Speed can also be changed by touching the SPEED button on the Touchscreen Display, which accesses the NUMERIC KEYPAD. The incline level is set to zero by default. To change the incline and stay in the Workout Progress Screen, press the illuminated ARROW KEYS on the Control Panel, corresponding to the INCLINE button. Incline can also be changed by touching the INCLINE button on the Touchscreen Display which accesses the NUMERIC KEYPAD. CLASSIC WORKOUTS MANUAL The MANUAL program is a constant effort workout in which the user can change resistance level or speed at any time. RANDOM The RANDOM program creates a terrain of hills and valleys that varies with each workout. More than one million different patterns are possible. HILL The Life Fitness-patented HILL workout offers a variety of configurations for interval training. Intervals are periods of intense cardiovascular exercise separated by regular periods of lower-intensity exercise. The CLASSIC PROFILE WINDOW represents these high and low intervals as columns of light, which together have the appearance of hills and valleys. The computerized interval training workout has been scientifically demonstrated to promote greater cardiorespiratory improvement than steady-pace training. The HILL workout goes through four phases, each marked by different intensity levels. The CLASSIC PROFILE WINDOW displays the progress of these phases. As noted in the descriptions below, the heart rate should be measured at two stages in the workout to gauge its effectiveness. Wear the chest strap or continuously grip the Lifepulse handles. The Message Area does not display a request for a heart rate measurement, as it does with CARDIO, FAT BURN and the HEART RATE ZONE TRAINING programs. 1 Warm-up is a phase of low, gradually rising resistance, which brings the heart rate into the lower end of the target zone and increases respiration and blood flow to working muscles. 2 Plateau increases the intensity slightly, and keeps it steady, to bring the heart rate to the low end of the target zone. Check the heart rate at the end of this phase. 3 Interval Training is a series of increasingly steeper hills, alternating with valleys, or stints of recovery. The heart rate should rise to the high end of the target zone. Check the heart rate at the end of this phase. 3 Cool-down is a low-intensity phase that allows the body to begin removing lactic acid, and other exercise by-products, which build up in muscles and contribute to soreness. Each column, as seen in the CLASSIC PROFILE WINDOW and the chart above, represents one interval. The overall duration of the workout determines the length of each interval. Each workout is made up of 20 intervals, so the duration of each interval is equal to the duration of the entire workout divided by 20. 26 1 to 9 minutes: A workout with a duration of less than 10 minutes is insufficient for the HILL program to complete all four phases adequately. The program, therefore, condenses a workout of this duration at various stages. 10 to 19 minutes: The interval durations initially are set at 30 seconds for a 10-minute workout. For every minute over 10, each interval increases by three seconds. A 15-minute workout consists of 20 intervals at 45 seconds each. 20 to 99 minutes: All intervals last 60 seconds. If the user adds minutes to the pre-set duration while the workout is in progress, the program adds hills and valleys that are identical to the first eight intervals of the Interval Training phase. This pattern repeats until the workout is completed. HEART RATE + WORKOUTS FAT BURN The FAT BURN workout is designed to maintain a user’s heart rate at 65 percent of the theoretical maximum† (HRmax) for optimal results. Throughout the workout, the user wears a chest strap or grasps the Lifepulse sensors. If the user is not wearing a chest strap, the WORKOUT PROGRESS SCREEN displays a heart shape, and the Message Area prompts the user to grasp the sensors. The console continuously monitors and displays the heart rate, adjusting the intensity level of the treadmill to reach and maintain the target* (See note below). This system eliminates over- and under-training, and it maximizes the aerobic benefits of exercise by using the body's fat stores for fuel. CARDIO The CARDIO workout is virtually identical to FAT BURN; however the target heart rate* is calculated at 80 percent of the theoretical maximum† (HRmax). The higher target promotes cardiovascular improvement by placing a heavier workload on the heart muscle (See note below). NOTE: The intensity level is changed by incline. Speed can be only changed by the user. Change the target heart rate at any time by using the arrow keys under the THR, or by touching the THR button to access the Target Heart Rate Workout Setup Screen. HEART RATE HILL This program combines the CLASSIC HILL workout profile with the concept of Heart Rate Zone Training. The default target heart rate* is calculated as 80 percent of the theoretical maximum† (HRmax), but the user can adjust the target rate during the workout setup. All hills and valleys are percentages of HRmax. The workout consists of three hills that target three heart rate goals: The first hill brings the heart rate to 70 percent of HRmax. The second hill increases the rate to 75 percent of HRmax. The third hill matches the Target Heart Rate bringing the heart rate to 80 percent of HRmax. The valley always is defined as 65 percent of HRmax. 80% HRmax 70% HRmax 65% HRmax Hill Hill Hill 75% HRmax Valley Valley Valley 85%HRmax THR 65% 65% HRmax 65% HRmax HEART RATE HILL Workout Profile 144 BPM 135 BPM 127 BPM 117 BPM 117 BPM 117 BPM 117 BPM User Example: 80 percent of theoretical maximum (HRmax) (40 year old / 144 recommended BPM) After a standard three-minute warm-up, the workout progresses toward the first hill and heart rate goal. Once the user reaches 70 percent of HRmax, the hill continues for one minute. When the minute expires, the level decreases into a valley. Once the user's heart rate falls to 65 percent of HRmax, the valley continues for one minute. Then, the next hill begins with its corresponding heart rate goal. After the user completes the third hill/valley pair, the program returns to the first hill and repeats the cycle as long as the duration allows. At the end of the duration, the workout goes into a cool-down phase. If the heart rate goes above the theoretical maximum for more then 45 seconds, the treadmill automatically goes into pause mode. If the user does not reach a heart rate goal after five minutes, the MESSAGE CENTER displays a prompt to increase or decrease speed, depending on whether the workout is in a hill or valley phase. The program does not proceed to a new heart rate goal until the user reaches the current goal. † Defined by the American College of Sports Medicine's "Guidelines for Exercise Testing and Prescription" as equal to 220 minus an individual’s age. * Target Heart Rate (THR) is a percentage of the theoretical maximum. For example, a 40-year-old user's THR for the FAT BURN workout is 117. This workout targets 65 percent of the maximum, so the equation would be (220-40)*.65=117. For the CARDIO and HEART RATE HILL workouts it is 144, or 80 percent of the maximum; so the equation would be (220-40)*.80=144. 27 HEART RATE INTERVAL 80% HRmax Warm-up Hill Hill Hill This workout combines the CLASSIC HILL workout profile with the concept of Heart Rate Zone Training. The default target heart rate* is calculated as 80 percent of the theoretical maximum† (HRmax), but the user can adjust the target rate during the workout setup. The workout alternates between a hill, which brings the heart rate up to the target rate of 80 percent of HRmax, and a valley, which brings the heart rate down to 65 percent of HRmax. After a standard three-minute warmup, the workout progresses toward the first hill and heart rate goal. Once the goal is reached, the hill continues for three minutes. Then, the level decreases into a valley. Once the 65 percent of HRmax goal is reached, the valley continues for three minutes, after which the next hill begins. The user's fitness level determines the number of hills and valleys encountered within the duration. At the end of the duration, the workout goes into a cool-down phase. If the heart rate goes above the theoretical maximum† for more then 45 seconds, the treadmill automatically goes into pause mode. If the user does not reach a heart rate goal after five minutes, the MESSAGE CENTER displays a prompt to increase or decrease speed, depending on whether the workout is in a hill or valley phase. The program does not proceed to a new heart rate goal until the user reaches the current goal. 80% HRmax 80% HRmax Valley Valley Valley 65% HRmax 65% HRmax 65% HRmax HEART RATE INTERVAL Workout Profile 144 BPM 144 BPM 117 BPM 117 BPM 144 BPM 117 BPM 117 BPM User Example: 80 percent of theoretical maximum (HRmax) (40 year old / 144 recommended BPM) EXTREME HEART RATE This workout is designed to help more experienced users to break through fitness improvement plateaus. The workout alternates between two target heart rates** as quickly as possible. The effect is similar to that of running sprints. The user must wear a chest strap or grip the Lifepulse sensors throughout the workout. NOTE: It is recommended that users who run at speeds faster than 4.5 MPH wear the chest strap and do not use the Lifepulse sensors. When setting up the workout, the user enters a target heart rate and selects a walk speed and a jog speed. After a standard three-minute warm-up, the treadmill accelerates to the jog speed, and the incline increases, until the user reaches the target heart rate goal of 85 percent of the theoretical maximum† (HRmax). That target rate is maintained for a stabilizing period. Then, the incline is reduced to 0 percent, and the treadmill slows to the walk speed. When the heart rate falls to the 65 percent of HRmax goal, it is maintained there for a stabilizing period. The program repeats the alternating of speeds and incline levels, continuing this pattern throughout the duration. 85% HRmax 85% HRmax Stabilizing Period Stabilizing Period d gS pe e ed gS pe Jo ed Jo gS pe e e Sp ed ed e Sp e Sp Jo lk Wa lk Wa lk Wa d 85% HRmax Stabilizing Period Warm-up Cool Down 65% HRmax 65% HRmax EXTREME HEART RATE Workout Profile 153 BPM 153 BPM ed d d Jo gS pe e e Sp ed 118 BPM lk Wa e Sp ed Jo gS pe e Stabilizing Period lk Wa e Sp Jo gS pe e 153 BPM Stabilizing Period lk Wa d Stabilizing Period 118 BPM 118 BPM 118 BPM User Example 85 percent of theoretical maximum (HRmax) (40 year old / 153 recommended BPM) If the user does not reach a heart rate goal after five minutes, the MESSAGE CENTER displays a prompt to increase or decrease speed, depending on whether the workout is in a hill or valley phase. The program does not proceed to a new heart rate goal until the user reaches the current goal. † Defined by the American College of Sports Medicine's "Guidelines for Exercise Testing and Prescription" as equal to 220 minus an individual’s age. * Target Heart Rate (THR) is a percentage of the theoretical maximum (HRmax). A 40-year-old user’s recommended THR for the Heart Rate Interval workout is 144, or 80 percent of the maximum; so the equation would be (220-40)*.80=144. ** Target Heart Rate (THR) is a percentage of the theoretical maximum. For example, a 40-year-old user's THR for the Extreme Heart Rate workout is 153. The workout program targets a standard 85 percent of the maximum, so the equation would be (220-40)*.85=153. 28 HILL + WORKOUTS The Life Fitness patented HILL + workouts give even more ways to vary interval training. Based on the same principles as the CLASSIC HILL workout, Hill + workouts are customized to resemble different locations/training scenarios to add variety and challenge to Hill workouts. The AROUND THE WORLD workout is an interval-training workout in which the hills resemble scenes of various geographical areas. The CASCADES workout is a two-peak workout in which intensity levels gradually increase and decrease. The FOOTHILLS workout is a rolling hill workout with low intensity levels. The KILIMINAJARO workout is a hill workout in which the intensity levels gradually incline toward one ultimate peak and then gradually decline. ADVANCED WORKOUTS FIT TESTS LIFE FITNESS FIT TEST The treadmill Life Fitness Fit Test program is another exclusive feature of this versatile treadmill. The Fit Test workout measures cardiovascular fitness and can be used to monitor improvements in endurance every four to six weeks. The user must grasp the hand sensors (if equipped) when prompted or wear a heart rate chest strap, as the test score calculation is based on a heart rate reading. The workout duration will be five minutes at a 5% incline. Immediately afterward, the console will take the user's heart rate reading, calculate a fitness score, and display the score in the Message Area. The Fit Test is considered to be a submax VO2 (volume of oxygen) test. It gauges how well the heart supplies oxygenated blood to the exercising muscles, and how efficiently those muscles receive oxygen from the blood. Physicians and exercise physiologists generally regard this test as a good measure of aerobic capacity. To set up the Fit Test: Choose ADVANCED, FIT TESTS, LIFE FITNESS FIT TEST. Go through the setup screens for the Fit Test, including Weight, Age and Gender. Press ENTER after each selection to record the entry. (Gender does not require selecting Enter afterwards.) The setup screen for Speed will appear. (ENTER SPEED: 2-4.5 mph). Consult the following recommended fit test level chart for an appropriate effort level based on age, gender and activity level. Press ENTER after the selection. After the five-minute FIT TEST is completed, a FIT TEST score will be displayed. FIT TEST PROGRAM SUGGESTED EXERTION LEVELS Treadmill Fit Test Level Inactive Active Very Active 2-3 mph 3-4 mph 3.5-4.5 mph 3.2-4.8 kph 4.8-6.4 kph 5.6-7.2 kph NOTE: Treadmill will incline to 5% after a one minute warm-up. Suggested exertion levels should be used as a guideline for setting up the Fit Test program. The goal is to elevate the user's heart rate to a level that is between 60%-85% of their theoretical maximum heart rate (220-age). Within each suggested range, these additional guidelines can be used: Lower Half of Range Upper Half of Range higher age lower age lower weight higher weight* shorter taller * In cases of excessive weight, use lower half of range. 29 The computer will not accept: • heart rates less than 52 or greater than 200 beats per minute • body weights less than 75 pounds (34 kg) or greater than 400 pounds (181 kg) • ages below 10 or over 99 years • data input that exceeds human potential If an error is made when entering any Fit Test data, correct it by pressing CLEAR, inputting the correct information, and pressing ENTER. It is important to take the Fit Test under similar circumstances each time. Heart rate is dependent on many factors, including: • amount of sleep the previous night (at least seven hours is recommended) • time of day • time of last meal (two to four hours after the last meal is recommended) • time since last beverage containing caffeine or alcohol, or cigarette (at least four hours is recommended) • time since last exercised (at least six hours is recommended) For the most accurate Fit Test results, perform the Fit Test on three consecutive days and average the three scores. NOTE: To receive a proper Fit Test score, the work done must be within a training heart rate zone that is 60 percent to 85 percent of the theoretical maximum heart rate (HRmax). This rate is defined by the American College of Sports Medicine's "Guidelines for Exercise Testing and Prescription" as equal to 220 minus an individual's age. The tables below list fit test results. RELATIVE FITNESS CLASSIFICATION Men FOR MEN Estimated VO2 Max (ml/kg/min) Per Age Category Rating 20-29 30-39 40-49 ELITE 52+ 51+ 48+ Excellent 50-51 48-50 46-47 42-44 39-41 Very Good 47-49 45-47 43-45 40-41 36-38 Above Average 44-46 42-44 40-42 37-39 33-35 AVERAGE 41-43 39-41 37-39 34-36 30-32 Below Average 38-40 36-38 34-36 31-33 27-29 Low 35-37 33-35 31-33 28-30 24-26 Very Low <35 <33 <31 <28 <24 30 50-59 60+ 45+ 42+ RELATIVE FITNESS CLASSIFICATION Women FOR WOMEN Estimated VO2 Max (ml/kg/min) Per Age Category Rating 20-29 30-39 40-49 50-59 60+ Elite 44+ 42+ 39+ 35+ 34+ Excellent 42-43 40-41 37-38 33-34 32-33 Very Good 39-41 37-39 35-36 31-32 30-31 Above Average 37-38 35-36 32-34 29-30 28-29 Average 34-36 32-34 30-31 27-28 25-27 Below Average 31-33 29-31 27-29 25-26 23-24 Low 28-30 27-28 25-26 22-24 20-22 Very Low <28 <27 <25 <22 <20 Life Fitness developed this rating scale based on VO2 max percentile distributions referenced in American College of Sports Medicine's "Guidelines for Exercise Testing and Prescription" (6th Ed. 2000). It is designed to provide a qualitative description of a user's VO2 max estimation, and a means of assessing initial fitness level and tracking improvement. MILITARY When enabled the Life Fitness Treadmill features additional fitness tests based upon specific predefined protocols. (See Section 5.1 Manager’s Configuration, Fit Tests, for information on how to enable these tests.) ARMY PFT: 2.0 miles The U.S. Army Physical Fitness Test is a physical performance test used to assess muscular endurance and cardiorespiratory fitness. NAVY PRT: 1.5 miles The running portion of the U.S. Navy Physical Readiness Test is a distance goal test based on the time needed to complete the required distance and is used by the U.S. Navy and Naval academies to measure aerobic capacity. MARINES PFT: 3.0 miles The U.S. Marines Physical Fitness Test is a physical performance test used to assess muscular endurance and cardiorespiratory fitness. AIR FORCE PRT: 1.5 miles The U.S. Air Force Physical Readiness Test is a physical performance test used to assess muscular endurance and cardiorespiratory fitness. GERKIN: Submaximal VO2 The Gerkin Protocol is a graded submaximal VO2 test by the International Association of Fire Fighters to determine fitness for fire department safety. PHYSICAL EFFICIENCY BATTERY: 1.5 miles The Physical Efficiency Battery is used by U.S. Federal Law Enforcement, U.S. Federal Bureau of Investigation, and other federal organizations for the hiring and maintenance of federal jobs. Scores for these tests are based on finishing time, age, and gender. To set up one of these tests, select ADVANCED workouts, FIT TESTS, MILITARY and choose the desired test. Then, press ENTER. If the selected test is either the NAVY or MARINES test, the MESSAGE CENTER displays a question as to whether the test is taking place below a certain altitude. For the NAVY test, the altitude is 5,000 feet above sea level; and for the MARINES test, the altitude is 4,500 feet above sea level. Using the ARROW KEYS, select the answer “ABOVE 5,000 FEET”(NAVY) / “ABOVE 4,500 FEET”(MARINES) or “BELOW 5,000 FEET”(NAVY) / “BELOW 4,500 FEET”(MARINES) by toggling between these words displayed in the MESSAGE CENTER. Press ENTER. 31 At the MESSAGE CENTER prompts, enter the weight, age, gender, and desired speed, using the ARROW KEYS or the NUMERIC KEYPAD. Press ENTER after each entry. Then, begin the workout. To ensure an accurate test score, do not change these entries once the workout begins. For all FITNESS TESTS except GERKIN, after the distance goal is reached, the workout program goes into a cool-down. The duration of this phase depends on the amount of time taken to complete the test. For less than five minutes, the cooldown is one minute. For five to 15 minutes, the cool-down is three minutes. For longer times, the cool-down is five minutes. The user can abort the Cool Down by pressing the STOP key. After the Cool Down is aborted or completed, the MESSAGE AREA displays the finishing time and a point score for the PEB, Army, Air Force, and Marines tests; or a qualitative score, such as EXCELLENT, for the Navy test. For the Gerkin test, the time at which the heart rate reached the target heart rate and is maintained for 15 seconds, and a converted VO2 MAX value will be shown in the MESSAGE AREA during the workout summary. SPORT TRAINING SPORT TRAINING (5K) is a distance-goal workout that simulates an actual terrain with varying incline levels. It is designed to assist runners in training for a 5-kilometer, or 3.1-mile, race. SPORT TRAINING (10K) is a distance-goal workout that simulates an actual terrain with varying incline levels. It is designed to assist runners in training for a 10-kilometer, or 6.2-mile, race. SPEED TRAINING is a Hill workout in which the intensity level alternates between high and low levels very quickly to simulate a typical speed-training workout. SPEED INTERVAL allows the user to toggle between user defined jog and run speeds. The user can toggle the speeds at any time during the workout, or adjust the speeds “on the fly.” CREATE YOUR OWN CREATE YOUR OWN workouts enable the user to design personalized workouts based on SPEED INTERVAL or on HEART RATE INTERVAL. CREATE YOUR OWN WORKOUTS may be disabled through the manager’s configuration screen (See Section 5.2, Configuration Menu, Manager’s Configuration 2, Create Your Own Manager Configuration, for details). Users cannot name and save their workout. 32 WORKOUT LANDSCAPE™ PERSPECTIVES Workout Landscapes provide users with three additional ways to visualize progress through a workout. Users can switch views by pressing the CHANGE VIEW key while in the Workout Progress Screen or by pressing the corresponding illuminated key on the Control Panel. 1) 400-METER TRACK (DEFAULT) The 400-Meter Track appears whenever a workout begins. This Landscape shows the current workout as an indicator line that traces a path around a 400-meter track, marking off 100-meter intervals. Every time the user travels 400 meters, taking the indicator line all the way around the track, the lap counter in the lower left of the profile screen increases by one and the indicator line starts over at the beginning of the track. To return to the 400-Meter Track after selecting a Workout Landscape, touch the CHANGE VIEW button on the Workout Progress Screen and select 400-Meter Track. 2) CLASSIC PROFILE Switch to the Classic Profile by touching the CHANGE VIEW button on the Workout Progress screen and selecting Classic Profile. This view shows the level of intensity in a workout-in-progress as proportional columns. The height of the column furthest to the left is proportional to the current level of intensity. 3) MOUNTAIN Switch to the Mountain Landscape by touching the CHANGE VIEW button on the Workout Progress Screen and selecting Mountain Landscape. This Landscape shows the current workout as an indicator line that traces a path up the face of a 2,000 foot / 610 meter high mountain. Every time the user climbs the equivalent of 2,000 feet / 610 meters, taking the indicator line to the top of the mountain, the mountain counter in the lower left of the profile screen increases by one and the indicator line starts over at the base of the mountain. 4) 5K NATURE TRAIL Switch to the 5K Nature Trail Landscape by touching the CHANGE VIEW button on the Workout Progress Screen and selecting 5K Nature Trail. This Landscape shows the current workout as an indicator line that traces a path around a 5-kilometer trail, marking off 1-kilometer intervals. Every time the user travels 5 kilometers, taking the indicator line all the way around the trail, the lap counter in the lower left of the profile screen increases by one and the indicator line starts over at the beginning of the trail. 33 4.4 MAXIMIZING WORKOUTS ON A LIFE FITNESS TREADMILL SELECTING A LEVEL The steps for setting up a CLASSIC HILL, CLASSIC RANDOM, HILL +, SPORT TRAINING 5K, and SPORT TRAINING 10K workout include selecting a level. The word “level” refers to a range of incline percentages. The treadmill features 20 levels, with Level 1 having the lowest average incline grade and Level 20 having the highest. LEVEL 1 2 3 4 5 6 7 8 9 10 % Incline 0.0 - 1.5 0.0 - 2.2 0.0 - 2.9 0.0 - 3.6 0.0 - 4.3 0.0 - 5.0 0.0 - 5.7 0.0 - 6.4 0.5 - 7.1 1.5 - 7.8 LEVEL 11 12 13 14 15 16 17 18 19 20 % Incline 2.0 - 8.5 3.0 - 9.2 3.5 - 9.9 5.0 - 10.6 5.5 - 11.3 6.5 - 12.0 7.0 - 12.7 8.0 - 13.4 8.7 - 14.1 9.0 - 15.0 Within each level are seven incline percentages, or hills. During a workout, each hill appears in the CLASSIC PROFILE window as rows of light stacked in a column. The number of lit rows within a column corresponds to an incline percentage. For example, in Level 5, the lowest incline is 0.0 percent and is represented as one lit row. The highest incline, 4.3 percent, is represented by a column with all seven rows lit. In the CLASSIC HILL and CLASSIC RANDOM workouts, these varying hills occur for equal durations, as discussed in the CLASSIC HILL workout description. When the workout program brings up a new hill, the incline percentage changes automatically to match that hill. To change levels during a workout, press the illuminated ARROW KEYS on the Control Panel under the INCLINE button. COOL DOWN Life Fitness' unique Cool Down Protocol automatically customizes every cool down based on each user's workout performance. Workout performance factors, such as speed, incline, duration, and heart rate, determine the duration and intensity of the cool down. 4.5 ADDITIONAL FEATURES AUDIO CUES Audio Cues alert users to stages of their workout. Note that audio events are disabled while the TV features are in operation. The manager may also disable Audio Cues through the Manager's Configuration screen (See Manager’s Configuration for details). 34 • Startup Sound: Plays when a workout begins, such as when the Quick Start key is pushed or the workout timer starts running on any other workout. • Pause Sound: Plays when a workout is paused and when a paused workout resumes. • Finish Sound: Plays when a workout enters the cool down phase, when a workout is complete, and when the Workout Summary is displayed. • Heartbeat Sound: Plays to prompt the user to grasp the contact heart rate sensors. IPOD COMPATIBILITY This compatibility makes it possible for iPod users to plug in and charge their iPods and iPod nanos, control their iPod playlists from the console and watch iPod-delivered video on the optional Life Fitness Attachable TV. Users can plug their headphones directly into the equipment console or their iPod while safely storing their player in the iPod holding tray. VIRTUAL TRAINER Life Fitness recognized the growing need to provide ongoing workout support for a broader range of exercisers. The 95 Series Treadmills provide exercisers with a unique tool at their fingertips - the Life Fitness Virtual Trainer - to motivate and educate over the duration of their workout. Created for beginners as well as the frequent fitness equipment user, the Virtual Trainer takes the intimidation out of beginning a new workout and provides ongoing encouragement. With the push of a button, a male or female face appears on the integrated LCD screen and advises the user on every aspect of the workout, from describing workout programs to updates on workout statistics including distance, calories and time. After selecting the desired Virtual Trainer, the Select Workout screen will appear and the user will be taken through the steps in Section 4.22. USB CONNECTIVITY Users can create and save workouts and personal settings, such as weight, goals and speed on any USB stick so that they don’t have to enter the data again the next time they work out. This feature also enables users to track workout performance by allowing them to save their workout results to the USB stick at the end of the workout. ZOOM FEATURE Ability to enlarge the speed, incline and time displays and enables easier workout data viewing. MEDIA CENTER Two entertainment options are available through the Media Center: Life Fitness Attachable Television and iPod. Users can control the channels and volume on the Life Fitness Attachable TV as well as access iPod data. 35 5 SYSTEM OPTIONS MENU 5.1 USING THE SYSTEM OPTIONS MENU Fitness club managers and other authorized personnel can use the Systems Options feature to change default settings, or to enable or disable certain programs or displays on the treadmill console, and to run systems checks. To enter the Systems Options, press SELECT WORKOUT and then touch the Life Fitness logo in the upper right hand corner of the screen three consecutive times. SYSTEM OPTIONS OVERVIEW SYSTEM TEST Allows technicians to run systems diagnostics. NOTE: These tests should only be used by (or with the express instruction of) a trained Life Fitness service technician. SYSTEM TEST MENU 1 SYSTEM TEST MENU 2 System Comm Test Stride Sensor Test Motor Modules EEPROM Test Key Pad Test CSafe Network Test Heart Rate Test CSafe Loopback Test iPod Test Test Engineering INFORMATION System usage statistics on main motor. Allows authorized personnel to access statistics on machine usage (Statistics and Usage Log). All other information is designed for use by trained Life Fitness service technicians. Statistics Date and TIme Information Software Versions System Errors Main Motor Information Maintenance Information Lift Motor Information Usage Log Belt/Deck Information CONFIGURATION Allows access to all of the configurable settings of the unit. Configurations which should only be changed by qualified technicians are password protected. Manager Create Your Own Manufacturer (password protected) Export/Import Settings Clock MAINTENANCE Allows service technicians to submit part replacements. Only for use by qualified service technicians. Replacing Belt and Deck Replacing Stop Switch Replacing Console Replacing Overlay Bezel Replacing Motor Controller Replacing Main Motor Replacing Lift Motor 36 5.2 CONFIGURATION MENU MANAGER Allows the manager to set unit defaults, configure workout duration, set stand by, and program custom messages. Choosing Manager accesses Manager’s Configuration 1. The forward button on the bottom right of the screen opens Manager’s Configuration 2. Manager’s Configuration 1 accesses defaults for Language, Units (English or Metric), Maximum and Minimum Speed, Workout Duration Configuration, and Stand By Configuration. Manager’s Configuration 2 accesses defaults for Distance Climbed, Fit Tests, Telemetry, Pause Time, Max % Incline, System Beeps, Stride Sensor, Accel Rate and Decel Rate, Custom Message Setup, Program Timeout, Marathon Mode and Belt Notification Icon. TO SET DEFAULTS Select appropriate buttons to select toggle settings. Use the arrow keys to modify variable default values. Select DEFAULTS to return all values to original factory settings. See chart 5.3 for an overview of adjustable configurations and factory defaults of the Life Fitness Treadmill. 1) MANAGER’S CONFIGURATION 1 LANGUAGE (DEFAULT: ENGLISH) To enable the Language option, select the Language button to enter the Language Setup screen. Toggle the mode from DISABLED to ENABLED. The following can be configured: 1. Default language 2. Names of the 13 languages available to the user 3. Order of the language flags appearing on the Home Screen 4. Flag choice representing those languages that may have multiple options The available language flags appear on the Home Screen. The user must select a language change before beginning a workout. If more than five languages are configured available, a MORE FLAGS button will appear which will open a language selection screen for the user. Upon selecting a language flag, the language will immediately become active and the selection screen will close. The following languages are available: English, German, French, Italian, Japanese, Dutch, Spanish, Portuguese, Korean, Russian, Turkish, Traditional Chinese, and Simplified Chinese. UNITS (DEFAULT: ENGLISH) Toggle the default units displayed between ENGLISH and METRIC. Choose “User Selectable” to allow users to choose desired units on-screen during a workout. WORKOUT DURATION CONFIGURATION (DEFAULT: 60 MINUTES) Workout Duration Configuration: Allows the manager to set a maximum workout limit. The default Max Workout Duration is 60 minutes. The time can be modified using the up or down arrow keys. STANDBY CONFIGURATION (DEFAULT: ENABLED) Inactivity Timer — Under Stand By Configuration choose INACTIVITY TIMER, then select ENABLED. Set the desired amount of time of inactivity before the system automatically turns the LCD screen backlight off. The LCD screen will illuminate the next time activity is detected. To turn off the Inactivity Timer, choose DISABLED. 2) MANAGER’S CONFIGURATION 2 ACCELERATION AND DECELERATION RATES (DEFAULT: 3) These configurations allows for increase or decrease in the amount of time taken to bring the running belt to speed. The rate can be set from 1 to 5 in single digit increments; 1 being the slowest rate (most time taken) and 5 being the fastest rate (shortest time taken). Use the arrow keys to adjust the value. 37 CUSTOM MESSAGE (DEFAULT: ENABLED) This configuration allows for a custom message to be displayed across the Home Screen. Creating/Changing a Custom Message — Upon entering the Custom Message Setup screen, a message can be entered using the on-screen keyboard. Use the Shift button to input special characters and capital letters. The message will scroll across the top of the screen as the message is being input, giving real-time feedback. Accepting a Custom Message — To accept the Custom Message, simply select the Main Menu button. Erasing a Custom Message — To erase a Custom Message, enter the Custom Message Setup screen. Select the Clear Message button and then select Main Menu. PROGRAM TIMEOUT (DEFAULT: 60 SECONDS) Sets the amount of time the user can go without touching the Touchscreen while setting up their workout, before the console resets back to the Home Screen. Program Timeout can be set from 20 to 255 seconds. The unit default is 60 seconds. CREATE YOUR OWN MANAGER CONFIGURATION (DEFAULT: ENABLED) The Create Your Own Manager Configuration allows the manager to enable or disable the Create Your Own workout feature. FIT TESTS (DEFAULT: OFF) Choose ON to enable the six additional military fit tests. If Fit Tests are OFF, the only fit test that will appear is the Life Fitness Fit Test. MARATHON MODE (DEFAULT: DISABLED) Marathon Mode has no preset or setable goal. It allows the user to workout indefinitely. If enabled, a workout in Marathon Mode ends only if the user chooses to end it or a stop system is activated. AUDIO CUES MANAGER CONFIGURATION The Audio Cues Manager Configuration allows the manager to enable or disable the Audio Cues feature. 4) TOUCH SCREEN CONFIGURATION Follow the instructions on the screen to recalibrate the Touchscreen. When finished touch anywhere on the screen to return to the Main Menu. 5) EXPORT/IMPORT SETTINGS Brings up the Export / Import Settings screen which is used to import or export manager and manufacturer configurable settings. This can be advantageous when many or all optional features are enabled and configured. To Import or Export Settings: Insert a USB stick into the USB port. Enter the Import/Export Settings through the Configuration Menu. Select ”Import Settings to USB” or “Export Settings To USB”. Upon notification, remove the USB stick from the USB port. NOTE: It is important to turn the unit off before inserting or removing the USB stick. NOTE: Exported setting information is product specific. Treadmill settings can only be imported into other, same model treadmills. Treadmill settings cannot be used to update settings of any other product. NOTE: This method is not recommended for the setup of the optional Life Fitness Attachable TV. 38 5.3 CONFIGURATION SETTINGS MANAGER’S CONFIGURATION 1 SETTING LANGUAGE DEFAULT ENGLISH DESCRIPTION The language of the Message Center display. Choices include English, German, French, Italian, Japanese, Dutch, Spanish, Portuguese, Korean, Russian, Turkish, Traditional Chinese and Simplified Chinese. ENGLISH/METRIC UNITS ENGLISH The measurement unit type for weight, distance, and speed. MAXIMUM SPEED 14.0 (MPH) for 95Ti This is the fastest speed at which the treadmill can operate. MINIMUM SPEED 0.5 (MPH) This is the slowest speed at which the treadmill can operate. WORKOUT DURATION 60 MINUTES This feature enables fitness club managers to set workout duration limits during peak and nonpeak hours of club traffic. If the setup is off, no duration limits are set. See the topic Section 5.1, Workout Duration Configuration. The allowed range is 1 to 99 minutes. STANDBY CONFIGURATION Enabled Inactivity Timer: Enables the LCD screen backlight to be turned off due to inactivity. See Section 5.1, Standby Configuration. MANAGER’S CONFIGURATION 2 SETTING DEFAULT DESCRIPTION DISTANCE CLIMBED DISPLAY OFF The total distance climbed, based on the incline and speed of the treadmill. FIT TESTS OFF Turning Fit Tests off only allows access to the Life Fitness Fit Test. Turning this feature on accesses the other 6 military fitness tests. SYSTEM BEEPS ON Enable/Disable System Beeps. PAUSE TIME 1 (minute) The amount of time the unit can be inactive before it reverts back to the Home Screen. The allowed range is 1 to 99 minutes. MAXIMUM % INCLINE 15.0 This option changes the maximum incline grade to a value lower than 15 percent. MARATHON MODE DISABLED Enable/Disable Marathon Mode. TELEMETRY ENABLED Switching on the telemetry feature makes it possible to use the Polar®-compatible Heart Rate Zone Training exercise chest strap for monitoring the heart rate. ACCELERATION RATE 3 The rate at which the treadmill accelerates to the selected speed, ranging from 1 (slowest) to 5 (fastest). CUSTOM MESSAGE SETUP ENABLED See Using the Custom Message Setup in this section. CREATE YOUR OWN ENABLED This feature allows the manager to enable or disable the Create Your Own Workout feature. STRIDE SENSOR ON This feature automatically pauses the workout if the user steps off the belt. PROGRAM TIMEOUT 60 Seconds The amount of time the user can go without touching the Touchscreen during workout setup, before the unit returns to the Home Screen. The allowed range is 20 to 255 seconds. DECELERATION RATE 3 The rate at which the treadmill decelerates to the selected speed, ranging from 1 (slowest) to 5 (fastest). BELT NOTIFICATION ICON OFF IF ENABLED, This option will alert a fitness club manager if a belt notification exists. 39 5.4 SPECIFICATIONS LIFE FITNESS 95TI CONSOLE SPECIFICATIONS 3 Console Option: 7” E Integrated LCDTM System with Touch Screen Technology Resolution: 800x480 Headphone Jack: 300 milliwatt, 3.5mm Stereo Control Panel: Arrow Keys, Cool Down, Pause, Incline, Speed, Media, Volume, Channel, Change View, Change Workout, Virtual Trainer Touch Screen: 4-Wire Resistive Touch Screen Touch Screen Display: Quick Start, Select Workout, Virtual Trainer, USB Preset Selection, Workout Setup, Workout Progress, Workout Summary Information, Media Center, Language Select, Screen Lock/Unlock Workouts: Quick Start // Classic: Manual, Random, Hill // Heart Rate +: Fat Burn, Cardio, Heart Rate HillTM, Heart Rate IntervalTM, Extreme Heart RateTM // Hill +: Around the World, Foothills, Kilimanjaro, Cascades // Advanced: Fit Tests (Life Fitness, Gerkin Protocol, Physical Efficiency Battery, Army PFT, Navy PRT, Air Force PRT, Marines PFT) // Create Your Own: Create Your Own (Speed Interval and Heart Rate Interval) // Sport Training TM: Sport Training (5K), Sport TrainingTM (10K), Speed Training, Speed Interval Levels: 20 (Hill, Random, 5K and 10K workouts) Manager-Defined/ User-Selected Languages: English, Spanish, Portuguese, Italian, French, German, Dutch, Russian, Chinese (traditional and simplified), Japanese, Turkish, and Korean Display Readout: Speed, Incline, Heart Rate, Pace, Elapsed Time, Time Remaining, Time in Zone, Time of Day, Distance, Distance Climbed, Distance Remaining, Calories, Calories per Hour TV Control Features: 125 available channels, Channel Controls, Previous Channel, Closed Captioning, Secondary Audio Programming, Mute, Volume, Channel Select iPod Compatibility: iPod video capability on optional Attachable TV iPod/iPod nano playlist management and LCD screen iPod/iPod nano power and charging 40 5.5 WARRANTY INFORMATION WHAT IS COVERED: This Life Fitness commercial exercise equipment (“Product”) is warranted to be free of all defects in material and workmanship. Friday from 8:00 a.m. to 6:00 p.m. Central Standard Time, and tell them your name, address and the serial number of your Product. They will tell you how to get a replacement part, or, if necessary, arrange for service where your Product is located or advise you on how and where to ship the Product for service. Before shipping: 1. obtain a Return Authorization Number (RA#) from Customer Support Services 2. securely pack your Product (use the original shipping carton, if possible) 3. write the RA# on the outside of the carton 4. insure the Product, and 5. include a letter explaining the defect or problem and a copy of your proof of purchase if you believe the service is covered by warranty EXCLUSIVE WARRANTY: THIS LIMITED WARRANTY IS IN LIEU OF ALL OTHER WARRANTIES OF ANY KIND EITHER EXPRESSED OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE, AND ALL OTHER OBLIGATIONS OR LIABILITIES ON OUR PART. We neither assume nor authorize any person to assure for us any other obligation or liability concerning the sale of this Product. Under no circumstances shall we be liable under this warranty, or otherwise, of any damage to any person or property, including any lost profits or lost savings, for any special, indirect, secondary, incidental or consequential damages of any nature arising out of the use of or inability to use this Product. Some states do not allow the exclusion or limitation of implied warranties or of liability for incidental or consequential damages, so the above limitations or exclusions may not apply to you. WHO IS COVERED: The original purchaser or any person receiving the Product as a gift from the original purchaser. HOW LONG IS IT COVERED: All coverage is provided by specific Product according to the guidelines listed on the chart accompanying this warranty card. WHO PAYS TRANSPORTATION & INSURANCE FOR SERVICE: If the Product or any covered part must be returned to a service facility for repairs, We, Life Fitness, will pay all transportation and insurance charges for the first year. You are responsible for transportation and insurance charges during the second and third years (if applicable). WHAT WE WILL DO TO CORRECT COVERED DEFECTS: We will ship to you any new or rebuilt replacement part or component, or, at our option, replace the Product. Such replacement parts are warranted for the remaining portion of the original warranty period. WHAT IS NOT COVERED: Any failures or damage caused by unauthorized service, misuse, accident, negligence, improper assembly or installation, debris resulting from any construction activities in the Product’s environment, rust or corrosion as a result of the Product’s location, alterations or modifications without our written authorization or by failure on your part to use, operate and maintain the Product as set out in your Operation Manual (“Manual”). All terms of this warranty are void if this product is moved beyond the continental borders of the United States of America (excluding Alaska, Hawaii and Canada) and are then subject to the terms provided by that country’s local authorized Life Fitness representative. CHANGES IN WARRANTY NOT AUTHORIZED: No one is authorized to change, modify or extend the terms of this limited warranty. EFFECT OF STATE LAWS: This warranty gives you specific legal rights and you may have other rights which vary from state to state. LIFETIME WARRANTY DEFINED AS FOLLOWS: Frame - excludes labor, handlebar assembly, bolted components or attached components that are not welded to the base powder coated frame. AC Motor - excludes labor, motor controller, bolted components or attached components to the AC motor. LifeSpring™ Shock Absorbers - excludes labor and mounting hardware. OUR PLEDGE TO YOU: Our Products are designed and manufactured to the highest standards. We want you completely satisfied with our Products and will do everything possible under the terms of this warranty to keep you secure in knowing you have bought the best! WHAT YOU MUST DO: Retain proof of purchase (our receipt of the attached registration card assures registration of purchase information but is not required); use, operate and maintain the Product as specified in the Manual; notify Customer Support Services of any defect within 10 days after discovery of the defect; if instructed, return any defective part for replacement or, if necessary, the entire Product for repair. OPERATION MANUAL: It is VERY IMPORTANT THAT YOU READ THE MANUAL before operating the Product. Remember to perform the periodic maintenance requirements specified in the Manual to assure proper operation and your continued satisfaction. WARRANTY REGISTRATION: Please COMPLETE and MAIL the attached registration card IMMEDIATELY. Our receipt assures that your name, address and date of purchase are on file as a registered owner of the Product. Failure to return the card will not affect your rights under this warranty. Being a registered owner assures coverage in the event you lose your proof of purchase. In any event, always retain proof of purchase, such as your bill of sale. HOW TO GET PARTS & SERVICE: Simply call Customer Support Services at (800) 351–3737 or (847) 451–0036, Monday through WARRANTY COVERAGE 95TI 2 YEARS 7 YEARS MODEL 6 MONTHS 1 YEAR Treadmills 95Ti  Drive Motor  Frame  Lifespring™Shock Absorbers  Electronics (i.e. PCBs such as motor controller and console board)  Mechanical (i.e. belt and deck)  Console Overlay  Electro-Mechanical (i.e. switches, lift motor, wax pump, electrodes)  Line Cord  Plastic Parts  Wax Kit  Labor *NOTE - Once any commercial product is placed in a private residence (home), it automatically becomes covered under that product category's consumer warranty. Warranty coverage begins at the original date of sale. 41 M051-00K70-A003 Life Fitness World Headquarters 5100 North River Road Schiller Park, IL 60176 95T ELEVATION SERIES TREADMILLS Service Manual 0.$ Table of Contents Table of Contents 2 Introduction 5 Using This Manual 6 Contact Information 7 System Level Troubleshooting 9 Preparation 10 Required Service Tools 11 Specialty Tools 12 Maintenance 13 Preventive Maintenance Schedule 14 Modules 19 Drive Motor (DS) 20 System Component 20 Problem Symptoms Table 21 How To’s 22 Base Frame Electronics (BE) 24 Theory of Operation 24 System Components 28 Problem Symptom Table 29 Troubleshooting Flow Diagrams 31 How To’s 34 Electrical Wiring Diagrams 38 Lift System (LS) 41 Theory of Operation 41 System Components 42 Problem Symptom Table 44 How To’s 46 Console & Activity Zone (CA) 51 2 Table of Contents Theory of Operation 51 System Components 55 Problem Symptom Table 58 Troubleshooting Flow Diagrams 61 How To’s 72 Electrical Wiring Diagrams 75 Heart Rate System (HR) 77 Lifepulse® Theory of Operation 77 System Components 79 Problem Symptom Table 80 How To’s 81 Stride (Walking) System (SS) 83 Theory of Operation 83 System Components 84 Problem Symptom Table 85 How To’s 88 Lower Frame (LF) 95 System Components 95 Problem Symptom Table 96 How To’s 97 Upper Frame (UF) 102 System Components 102 Problem Symptom Table 103 How To’s 104 Appendix 109 Engage / Inspire Console Diagnostic 110 Overview 110 System Options - Block Diagram Overview 111 System Options - Main Menu 112 System Test Menu 1 113 System Communication Check 114 Motor Modules (TR Only) 115 System Diagnostics Check (Non – TR only) 116 Key Pad Test 117 Heart Rate Test 118 3 Table of Contents iPod® Test 119 Test Engineering 120 System Test Menu 2 121 Stride Sensor Test (TR only) 122 External Serial EE Test 123 CSAFE Network Test or Status 124 CSAFE Loopback Test 125 Information Menu 126 Information Statistics 127 Software Versions 129 Main Motor Information (TR Only) 130 Lift Motor Information (TR Only) 138 Belt / Deck Information (TR Only) 139 Date and Time Information 140 System Errors 141 Maintenance Information 142 Usage Log Report 143 Channel Usage Log 144  &RQ¿JXUDWLRQ0HQX   0DQDJHU&RQ¿JXUDWLRQ   0DQDJHU&RQ¿JXUDWLRQ   0DQXIDFWXUHU¶V&RQ¿JXUDWLRQ   9LGHR)05DGLR&RQ¿JXUDWLRQ0HQX  Video Setup Screen 152 Channel Name / Sort Setup Screen 153 Secure Channel Setup Screen 154 Promo Channel Setup Screen 155 FM Radio Setup Screen 156 Custom Workouts Screen 157 Export / Import Settings 158 Create Your Own Screen 159 1HWZRUN&RQ¿JXUDWLRQ  Clock Setup (Date and Time Information) 161 Maintenance 162  Error / Info Messages 163 4 Introduction Introduction Using This Manual M051-00K65-A003 7KLVVHUYLFHPDQXDOSURYLGHVVDIHDQGHI¿FLHQWWHVWDQGVHUYLFHSURFHGXUHVIRUWKH7(OHYDWLRQ6HULHVWUHDGPLOOV7KH service manual is arranged in the following sections: Introduction 7KLVVHFWLRQSURYLGHVWKHXVDJHJXLGHOLQHVFRQWDFWLQIRUPDWLRQWHFKQLFDOVSHFL¿FDWLRQVDQGJORVVDU\RIWHUPVXVHGLQWKLV PDQXDO Preparation 7KLVVHFWLRQSURYLGHVWKHOLVWRIVHUYLFHWRROVUHTXLUHGWRSHUIRUPYDULRXVVHUYLFHRSHUDWLRQVGHVFULEHGLQWKLVPDQXDO Maintenance 7KLVVHFWLRQGHVFULEHVDVXJJHVWHGSUHYHQWLYHPDLQWHQDQFHVFKHGXOHIRUWKHHTXLSPHQW Theory of Operation This section describes the working principle of a treadmill, described for various components such as mechanical, electrical DQGVRIWZDUH Electrical Wiring Diagrams 7KLVVHFWLRQFRQWDLQVDOOWKHHOHFWULFDOZLULQJGLDJUDPVIRUYDULRXVFRPSRQHQWVRIWKH7(OHYDWLRQVHULHVWUHDGPLOO$EDVLF EORFNOHYHOGLDJUDPLVH[SODLQHGIROORZHGE\GHWDLOHGZRUNLQJRIHDFKFRPSRQHQW Modules 7KLV VHUYLFH PDQXDO KDV EHHQ RUJDQL]HG E\ VHYHUDO RSHUDWLRQDO PRGXOHV RI WUHDGPLOO (DFK PRGXOH FRQWDLQV LWV RZQ WURXEOHVKRRWLQJJXLGHVV\PSWRPWDEOHVDQGÀRZGLDJUDPV HOHFWULFDOZLULQJGLDJUDPVLIUHTXLUHG DQG+RZ7R¶V Index 7R¿QGLQIRUPDWLRQZKHQDVHUYLFHSUREOHPRFFXUV ‡ 8VHWKHWRSOHYHOWURXEOHVKRRWLQJJXLGHOLQHWRGHWHUPLQHWKHPRGXOH ‡ &KHFNWKHFRUUHVSRQGLQJPRGXOHVHFWLRQ¶VWURXEOHVKRRWLQJWR]RRPLQWRWKHURRWFDXVH ‡ )ROORZWKHVHUYLFHSURFHGXUHVGHVFULEHGXVLQJWKH+RZ7R¶VVHFWLRQIRUWKHPRGXOH 5HIHUWR(OHFWULFDO:LULQJ'LDJUDPVVHFWLRQIRUYDULRXVEORFNGLDJUDPVDQGFRQQHFWRUORFDWLRQV8QOHVVRWKHUZLVHVSHFL¿HG VWDQGDUGWRROVOLVWHGLQWKH3UHSDUDWLRQVHFWLRQVKRXOGEHXVHG 6 Introduction Contact Information M051-00K65-A003 To speed Life Fitness Customer Support Service’s response, please provide the following information to the customer support technician: ‡0RGHOQXPEHU ‡6HULDOQXPEHUDOHWWHUQXPEHUVHTXHQFH  ‡6\PSWRPRISUREOHP Front View Rear View Location of model and serial numbers Location of model and serial numbers Corporate Headquarters 5LYHU5RDG6FKLOOHU3DUN,OOLQRLV86$ Toll-Free:ZLWKLQ86$&DQDGD Tel: (847) 288 3300 Fax: (847) 288 3703 Global Website: ZZZOLIH¿WQHVVFRP ,QWHUQDWLRQDO2I¿FHV AMERICA’S NORTH AMERICA Life Fitness Inc. LATIN AMERICA & CARIBBEAN* Life Fitness Inc. 15LYHU5RDG6FKLOOHU3DUN,/86$ Tel: (847) 288 3300 Fax: (847) 288 3703 Service Email:LQWHUQDWLRQDOVHUYLFHVXSSRUW#OLIH¿WQHVVFRP Sales/Marketing Email:FRPPHUFLDOVDOHV#OLIH¿WQHVVFRP Operating Hours: 7:00 am-6:00 pm (CST) 15LYHU5RDG6FKLOOHU3DUN,/86$ Tel: (847) 288 3300 Fax: (847) 288 3703 Service Email:LQWHUQDWLRQDOVHUYLFHVXSSRUW#OLIH¿WQHVVFRP Sales/Marketing Email: FRPPHUFLDOVDOHV#OLIH¿WQHVVFRP Operating Hours: 8:00am-5:00pm (CST) BRACTIVITY ZONEIL Life Fitness Do BrActivity Zoneil $Y'U'LE6DXDLD1HWR$OSKDYLOOH%DUXHUL SP 06465-140, BrActivity Zoneil Tel: (800) 773 8282 Fax:   Service Email: VXSRUWH#OLIH¿WQHVVFRPEU Sales/Marketing Email:OLIH¿WQHVV#OLIH¿WQHVVFRPEU Operating Hours: 8:30 am-17:30 pm (BRT) 7 Introduction Contact Information M051-00K65-A003 EUROPE, MIDDLE EAST & AFRICA (EMEA) NETHERLANDS & LUXEMBURG Life Fitness Atlantic BV BELGIUM Life Fitness Benelux NV Bijdorpplein 25-31, 2992 LB Barendrecht, The Netherlands Tel: (+31) 180 646 666 Fax: (+31) 180 646 699 Service Email:LQWHUQDWLRQDOVHUYLFHVXSSRUW#OLIH¿WQHVVFRP Sales/Marketing Email: PDUNHWLQJEHQHOX[#OLIH¿WQHVVFRP Operating Hours:KK&(7 Parc Industrial de Petit-Rechain, 4800 Verviers, Belgium Tel: (+32) 87 300 942 Fax: (+32) 87 300 943 Service Email:LQWHUQDWLRQDOVHUYLFHVXSSRUW#OLIH¿WQHVVFRP Sales/Marketing Email:PDUNHWLQJEHQHOX[#OLIH¿WQHVVFRP Operating Hours:KK&(7 UNITED KINGDOM & IRELAND Life Fitness UK LTD ALL OTHER EMEA COUNTRIES & DISTRIBUTOR BUSINESS CEMEA* Queen Adelaide, Ely, Cambs, CB7 4UB Tel *HQHUDO2I¿FH :  Tel (Customer Support):  Fax:  Service Email:XNVXSSRUW#OLIH¿WQHVVFRP Sales/Marketing Email:OLIH#OLIH¿WQHVVFRP Operating Hours: *HQHUDO2I¿FHDPSP*07 &XVWRPHU6XSSRUWDPSP*07 Bijdorpplein 25-31, 2992 LB Barendrecht, The Netherlands Tel: (+31) 180 646 666 Fax: (+31) 180 646 699 Service Email:VHUYLFHGEFHPHD#OLIH¿WQHVVFRP Sales/Marketing Email:PDUNHWLQJGEFHPHD#OLIH¿WQHVVFRP Operating Hours:KK&(7 GERMANY & SWITZERLAND Life Fitness Europe GMBH Siemensstrasse 3, 85716 Unterschleissheim, Germany Tel (Germany):  Tel (Switzerland): (+41) 0848 000 901 Fax (Germany):  Fax (Switzerland): (+41) 043 818 07 20 Service Email:NXQGHQGLHQVW#OLIH¿WQHVVFRP Sales/Marketing Email:NXQGHQEHUDWXQJ#OLIH¿WQHVVFRP Operating Hours:KK0(= AUSTRIA Life Fitness Austria 9HUWULHEV*PE+'FNHJDVVH9LHQQD$XVWULD Tel:  Fax:  Service Email:NXQGHQGLHQVW#OLIH¿WQHVVFRP Marketing/Sales Email:NXQGHQEHUDWXQJ#OLIH¿WQHVVFRP Operating Hours:KK0(= SPAIN Life Fitness IBERIA C/Frederic Mompou 5,1º1ª, 08960 Sant Just Desvern Barcelona, Spain Tel: (+34) 936 724 660 Fax: (+34) 936 724 670 Service Email:LQIRLEHULD#OLIH¿WQHVVFRP Sales/Marketing Email:LQIRLEHULD#OLIH¿WQHVVFRP Operating Hours: KK0RQGD\7KXUVGD\ KK)ULGD\ ITALY Life Fitness ITALIA S.R.L. ASIA PACIFIC (AP) JAPAN Life Fitness Japan 1LSSRQ%UXQVZLFN%OGJ) 5-27-7 Sendagaya Shibuya-Ku, Tokyo Japan 151-0051 Tel:  Fax:  Service Email:VHUYLFH#OLIH¿WQHVVMDSDQFRP Sales/Marketing Email:VDOHV#OLIH¿WQHVVMDSDQFRP Operating Hours:KK-$3$1 CHINA AND HONG KONG /LIH)LWQHVV$VLD3DFL¿F/7' Room 2610, Miramar Tower, 132 Nathan Road, Tsimshatsui, Kowloon, Hong Kong Tel:  Fax:  Service Email:+RQJ.RQJ(QTXLU\#OLIH¿WQHVVFRP Sales/Marketing Email:&KLQD(QTXLU\#OLIH¿WQHVVFRP Operating Hours:KK ALL OTHER ASIA PACIFIC COUNTRIES & DISTRIBUTOR BUSINESS ASIA PACIFIC* Room 2610, Miramar Tower, 132 Nathan Road Tsimshatsui, Kowloon, Hong Kong Tel:   Fax:  Service Email: +RQJ.RQJ(QTXLU\#OLIH¿WQHVVFRP Sales/Marketing Email:&KLQD(QTXLU\#OLIH¿WQHVVFRP Operating Hours:KK $OVRFKHFNZZZOLIH¿WQHVVFRPIRUORFDOUHSUHVHQWDWLRQRUGLVWULEXtor dealer 9LD&ULYHOOLQ1$I¿9HURQD,WDO\ Tel:  Fax:  ServiceEmail: DVVLVWHQ]DWHFQLFD#OLIH¿WQHVVFRP Sales/Marketing Email:LQIR#OLIH¿WQHVVLWDOLDFRP Operating Hours: KK&(7 8 Introduction System Level Troubleshooting M051-00K65-A003 SYMPTOM POSSIBLE CAUSE SECTION PAGE Belt not moving Treadmill not powered Base Frame Electronics BE 8 Console operation Console and Activity Zone CA 11 Motor does not start upon workout start Base Frame Electronics BE 8 From the general striding belt area Stride System SS 3 From the front end of the base Drive Motor DS 2 During incline / decline Lift System LS 4 Structural noise fom the base Lower Frame LF 2 Structural noise fom the upper frame Upper Frame UF 2 Console Console and Activity Zone CA 8 Upper structure Upper Frame UF 2 Base Lower Frame LF 2 Console Console and Activity Zone CA 8 Upper structure Upper Frame UF 2 Base Lower Frame LF 2 Error messages Error message displayed on the console Error / Info Message Table Page 163 Heart rate issue Polar or LifePulse® Heart Rate System HR 4 Networking issues CSAFE connected devices Console and Activity Zone CA 8 iPod®, USB and headphone issues Option panel Console and Activity Zone CA 17 Audio and video issues Console & console connections Console and Activity Zone CA 13, CA 20 Base external connections Base Frame Electronics BE 6 User interfaceissues Console interface (display, WRXFKVFUHHQHWF Console and Activity Zone CA 18 Software issues Installed software version is not the latest released Latest software update Instructions - Look it XSKHUHKWWSVZZZ OIWHFKVXSSRUWFRPZHE guest/software-releases N/A Noise and vibration Structural failure Appearance issues 9 Preparation Preparation Required Service Tools M051-00K65-A003 8QOHVVRWKHUZLVHVSHFL¿HGWKHVHWRROVDUHUHTXLUHGWRSHUIRUPWKHVHUYLFHSURFHGXUHVLQWKLVPDQXDO  6FUHZGULYHUV3KLOOLSVDQGÀDWEODGH   7RU[ELWVDQGGULYHUV  3OLHUVUHJXODUDQGQHHGOHQRVH  5XEEHURUGHDGEORZPDOOHW  Snap ring pliers (internal and external)  (ULQJWRROV  6RFNHWZUHQFKHV(QJOLVKDQGPHWULF  5DWFKHWZUHQFKHV(QJOLVKDQGPHWULF  &RPELQDWLRQRSHQHQGRUER[ZUHQFKHV(QJOLVKDQGPHWULF $OOHQKHDGZUHQFKHV(QJOLVKDQGPHWULF  6WUDSZUHQFK 0LQLÀDVKOLJKW 6FULEHRULQNSHQ 6WUDLJKWHGJH 1XWGULYHU´GULYHVRFNHWVHW 5HPRYDEOHWKUHDGORFNLQJFRPSRXQG±HJ/RFWLWHŠRU Break Free® &RUGRUWZLQH 'LDJRQDOFXWWHUVVPDOODQGPHGLXP EORFNVHJVFUDS´;´>PP[PP@ZRRG 0XOWLPHWHUZLWKWHVWOHDGV 7DSHPHDVXUH 7HOHVFRSLQJPDJQHW 6WHWKRVFRSH &DOLEUDWHGWRUTXHZUHQFKHV /LJKWOXEULFDWLQJRLOLHLQ 7)JUHDVH:KLWH/LWKLXP *UHDVHJXQ *UDEWRRO &HQWHUSXQFK $QWLVWDWLFVWUDS 2XWOHWWHVWHU 'UHPHOŠ 'ULOODQGH[WUDFWRUHDV\RXW %LWV 6RIWFORWK NOTE: 6SHFLDOL]HG WRROV PD\ EH UHTXLUHG WR FRPSOHWH VRPH VHUYLFH SURFHGXUHV VDIHO\ 8VLQJ WRROV LPSURSHUO\FDQUHVXOWLQGDPDJHWRHTXLSPHQWRUSHUVRQDOLQMXU\ 11 Preparation Specialty Tools M051-00K65-A003 Life Fitness Tools: %HDULQJUHPRYDOWRRONLWSQ bearing toolkit SQ NOTE:3DUWQXPEHUVDUHVXEMHFWWRFKDQJH 12 Maintenance Maintenance Preventive Maintenance Schedule ITEM WEEKLY Hardware MONTHLY QUARTERLY BIANNUALLY ANNUALLY Inspect for loose or damaged KDUGZDUH Replace if QHFHVVDU\ Reapply Loctite 242/243 DVQHHGHG Tighten torque bolts to recommended VSHFL¿FDWLRQV in the Service 0DQXDO Console / Activity Zone overlay Display Console / Activity Zone Assembly Clean with a mild soap and water, Original Dawn® dishwashing liquid UHFRPPHQGHG Accessory cups Clean with a mild soap and water, Original Dawn® dishwashing liquid UHFRPPHQGHG Cups are dishwasher VDIH iPod® connector Clean with dry / cable FORWK,QVSHFW cable and connector for GDPDJH USB port Clean with GU\FORWK Inspect pins for GDPDJH Emergency Clean with switch / key a mild soap and water, Original Dawn® dishwashing liquid UHFRPPHQGHG Inspect for GDPDJH Replace switch LIQHFHVVDU\ M051-00K65-A003 Inspect for damage, cracking, color IDGLQJHWF Replace if QHFHVVDU\ 14 Maintenance Preventive Maintenance Schedule ITEM WEEKLY Hardware M051-00K65-A003 MONTHLY QUARTERLY BIANNUALLY Inspect for loose or damaged KDUGZDUH Replace if QHFHVVDU\ Reapply Loctite 242/243 DVQHHGHG Tighten torque bolts to recommended VSHFL¿FDWLRQV Handlebar Inspect for cracking, color IDGLQJHWF Replace if QHFHVVDU\ Side handrails including shrouds Inspect for cracking, color IDGLQJHWF Replace if QHFHVVDU\ Bridge cover Clean with a mild soap and water, Original Dawn® dishwashing liquid recommended using a damp towel, follow up another damp cloth rinsed with clean water to remove any UHVLGXH'2 NOT scrub or use brushes on WKHVKURXGV LifePulse® sensors Clean with a mild soap and water, Original Dawn® dishwashing liquid UHFRPPHQGHG Inspect for GDPDJH Replace if QHFHVVDU\ Ergo™ Front Handlebar Assembly ANNUALLY Inspect for cracking, color IDGLQJHWF Replace if QHFHVVDU\ 15 Maintenance Preventive Maintenance Schedule ITEM WEEKLY M051-00K65-A003 MONTHLY Hardware BIANNUALLY ANNUALLY Inspect for loose or damaged KDUGZDUH Replace if QHFHVVDU\ Reapply Loctite 242/243 DVQHHGHG Tighten torque bolts to recommended VSHFL¿FDWLRQV Uprights and bolts to mount to the lower frame Clean with a mild soap and water, Original Dawn® dishwashing liquid UHFRPPHQGHG Inspect for GDPDJH Replace if QHFHVVDU\ Motor cover Clean with a mild soap and water, Original Dawn® dishwashing liquid recommended using a damp towel, follow up another damp cloth rinsed with clean water to remove any UHVLGXH'2 NOT scrub or use brushes on WKHVKURXGV Inspect for cracking, color IDGLQJHWF Replace as QHHGHG Frame Assembly QUARTERLY Inspect for loose or damaged KDUGZDUH Replace if QHFHVVDU\ Reapply Loctite 242/243 DVQHHGHG Tighten torque bolts to recommended VSHFL¿FDWLRQV Inspect for cracking, color IDGLQJHWF Replace if QHFHVVDU\ 16 Maintenance Preventive Maintenance Schedule ITEM WEEKLY Motor electronic compartment M051-00K65-A003 MONTHLY QUARTERLY Vacuum interior Drive belt BIANNUALLY Inspect À\ZKHHOGULYH pulleys cables, connectors, Lift Motor, motor control board, HWFIRUGDPDJH Use a nylon brush to remove GHEULV5HSODFH components as QHHGHG Inspect for excessive wear, HJFUDFNLQJ EHOWGHEULV Replace as QHHGHG Machine level / leg levelers Inspect for any rocking on the XQLW$GMXVWDV QHHGHG Front roller Inspect for excessive bearing axial DQGUDGLDOSOD\ Inspect roller for excessive wax EXLOGXS5HPRYH excessive wax EXLOGXS,QVSHFW the plastic drive pulley for cracks, warpage, or PLVVLQJJURRYHV Replace components as QHHGHG Rear roller Inspect for excessive bearing axial and radial SOD\5HPRYH excessive wax EXLOGXS5HSODFH components as QHHGHG Frame Assembly End caps ANNUALLY Clean with a mild soap and water, Original Dawn® dishwashing liquid UHFRPPHQGHG Inspect to see if end caps are damaged, cracked, faded, or ORRVH5HSODFH LIQHFHVVDU\ 17 Maintenance Preventive Maintenance Schedule ITEM WEEKLY MONTHLY QUARTERLY BIANNUALLY ANNUALLY Side shrouds Frame Assembly Clean with a mild soap and water, Original Dawn® dishwashing liquid UHFRPPHQGHG Inspect for loose KDUGZDUH Side extrusions Clean with a mild soap and water, Original Dawn® dishwashing liquid UHFRPPHQGHG Inspect for loose KDUGZDUH Anti-slip pads Clean with a mild soap and water, Original Dawn® dishwashing liquid UHFRPPHQGHG Inspect signs of SHHOLQJRII Walking belt Inspect for belt alignment/ tracking and correct DFFRUGLQJO\ Inspect the edges of the belt between the belt EDUULHUV5HIHU to Stride System 0RGXOH Roller guards Inspect for damage usually caused by users stepping on WKHP5HSODFH DVQHHGHG Visible deck Clean with a mild surface soap and water, Original Dawn® dishwashing liquid UHFRPPHQGHG Inspect for GDPDJH Replace if QHFHVVDU\ M051-00K65-A003 Inspect for excessive wear on the walking/ running surface and edges for excessive IUD\LQJ Replace as QHHGHG 18 Modules Modules DS 1 Drive Motor:System Component M051-00K65-A003 Set Screw Over Key (51-71 in-lbs) >NJFP@ Nut (9-13 ft-lbs) >1P@ QTY 4 Key Drive Belt Motor Nut (9-13 ft-lbs) >1P@ (Bolt for -03 models or higher) QTY 4 Flat Washer QTY 4 Shoulder Washer QTY 4 Idler Assembly Flywheel Flywheel Bolt (21-24 ft-lbs) >1P@ Spring Threaded Clevis Pin with Idler Support Shaft Shoulder Washer Bracket Drive Motor for -01 and -02 Models Motor Pulley Insulating Pad QTY 2 Clip (-03 models or higher) QTY 4 Drive Motor for -03 and higher Idler Assembly Clevis Pin Idler Support Bracket Tie Bar Frame Bracket (Never remove on -01 & -02 models) 20 Modules DS 2 Drive Motor:Problem Symptoms Table M051-00K65-A003 SYMPTOM POSSIBLE CAUSE SECTION PAGE Drive motor does not RSHUDWH Drive motor cable connection to controller IDXOW\ Check drive motor cable FRQQHFWLRQWRFRQWUROOHU BE 7 Wrong motor controller for power source (220 volt or YROW  Install proper motor FRQWUROOHU BE 12 )DLOHGPRWRUFRQWUROOHU Verify all connections Replace motor controller if UHTXLUHG BE 12 Thermal switch on motor PD\EHRSHQRUGHIHFWLYH Inspect across thermal switch leads with ohm meter (verify not open, and resistance less than one RKP  Is there an error message on the console? See troubleshooting ÀRZFKDUW BE 6 0RWRUÀ\ZKHHOXQEDODQFHG 5HSODFHÀ\ZKHHO DS 3 0RWRUVKDIWEHQW 5HSODFHPRWRU DS 3 )O\ZKHHOEROWORRVH 7LJKWHQÀ\ZKHHOEROW DS 3 Motor mounting hardware ORRVH Check hardware and WLJKWHQDFFRUGLQJO\ DS 3 Worn or damaged main GULYHEHOW Inspect main drive belt for GDPDJHRUZHDU5HSODFH LIQHFHVVDU\ DS 3 Drive motor pulley and front UROOHUSXOOH\PLVDOLJQHG $OLJQSXOOH\V DS 3 Motor bearings bad 5HSODFHPRWRU DS 3 Flywheel bolt loose and À\ZKHHOUXEELQJ 7LJKWHQÀ\ZKHHOEROW DS 3 Excessive vibration Squeaking noise when GULYHEHOWPRYHV Noise from Drive motor 21 Modules DS 3 Drive Motor:How To’s M051-00K65-A003 REMOVAL OF DRIVE MOTOR  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  Disconnect the cables between the drive motor and the motor FRQWUROOHU  ,QVHUWDÀDWEODGHVFUHZGULYHULQWRWKHVORWWHGHQGRIWKHLGOHU EUDFNHW  Raise idler bracket just enough to insert a screwdriver or an Allen ZUHQFKLQWRWKHDFFHVVKROHRIWKHLGOHUEUDFNHW7KLVZLOONHHSLWLQD UDLVHGSRVLWLRQ  5HPRYHWKHGULYHEHOWIURPDURXQGPRWRUSXOOH\  :LWKWKHÀDWEODGHVFUHZGULYHULQWRVORWWHGHQGRILGOHUKROGRQ to this screwdriver and slowly remove other screwdriver or Allen ZUHQFK  6ORZO\ORZHULGOHUEUDFNHWZLWKWKH¿UVWVFUHZGULYHU  5HPRYHVSULQJFOHYLVSLQDQGLGOHUEUDFNHW1RZ\RXDUHUHDG\WR UHPRYHPRWRU NOTE: For -03 models or higher the Idler Support Bracket with the LGOHUDVVHPEO\PXVWEHUHPRYHGEHIRUHSURFHHGLQJWRWKHQH[WVWHS Remove and save the 4 hex nuts, the 4 washers and the 4 plastic shoulder washers that secure the drive motor to the motor mounting VWXGVLQWKHIUDPH NOTE:PRGHOVRUKLJKHUKDYHEROWVLQVWHDGRIQXWV Line up hole in idler and hole in support bracket and insert Allen wrench or screwdriver Lift the drive motor assembly up and off the studs and out of the PRWRUSDQ)UDPHVRQPRGHOVRUKLJKHUKDYHZHOGQXWVLQVWHDG RIZHOGVWXGV  Drive Sheave NOTE: Never remove the tie bar frame bracket on -01 and -02 PRGHOV /RRVHQWKHVHWVFUHZVRQWKHGULYHPRWRUSXOOH\VKHDYH  5HPRYHWKHSXOOH\IURPWKHGULYHPRWRU 5HPRYHWKHÀ\ZKHHOIDQDVVHPEO\E\UHPRYLQJÀ\ZKHHOEROWDQG VHWDVLGH8VH7RRO$.3DUWRI7DSHUHG)O\ZKHHO 5HPRYDO.LW*.  ,QVWDOOWKHSUHYLRXVO\UHPRYHGÀ\ZKHHOIDQDVVHPEO\DQGGULYH SXOOH\VKHDYH RQWRWKHQHZGULYHPRWRU'RQRWWLJKWHQWKHGULYH pulley set screws until the roller pulley and drive pulley have been DOLJQHGDVVKRZQLQWKHVWHSVWKDWIROORZ Key Drive Sheave Set Screws (2) (51-71 in-lbs) >NJFP@ 22 Modules DS 4 Drive Motor:How To’s M051-00K65-A003 ,QVWDOOWKHQHZGULYHPRWRU5HXVHDQ\KDUGZDUHUHPRYHGDQGVDYHGLQSUHYLRXVVWHSV 6OLGHWKHGULYHPRWRUSXOOH\RQWRWKHPRWRUVKDIWDQGLQVWDOONH\LQWRSXOOH\DQGPRWRUVKDIWNH\ZD\ To align the drive motor pulley (sheave) with the front roller pulley: D8VLQJDVWUDLJKWHGJHDOLJQWKHRXWHUIDFHRIWKHGULYHPRWRUSXOOH\ZLWKWKHRXWHUIDFHRIWKHIURQWUROOHUSXOOH\ E6OLGHWKHGULYHPRWRUSXOOH\VKHDYH LQRURXWRQWKHVKDIWGXULQJDOLJQPHQW F7LJKWHQVHWVFUHZRYHUWKHNH\RQWKHGULYHPRWRUSXOOH\¿UVW5RWDWHPRWRUSXOOH\E\SXVKLQJRQWKHÀ\ZKHHOWR PDNHVXUHSXOOH\VKDYHEHHQSURSHUO\DOLJQHGDQGEHOWLVUXQQLQJWUXH7LJKWHQVHFRQGVHWVFUHZ Roller Pulley Straight Edge Motor Pulley (sheave) 5HLQVWDOOWKH,GOHUEUDFNHWDQGGULYHEHOW 23 Modules Base Frame Electronics:Theory of Operation BE 1 M051-00K65-A003 1. Overview The electronics in the base of Elevation Series treadmills control the main motor and Lift Motor, provides power to the FRQVROH DQG PRQLWRUV WKH VWULGH VHQVRU$OO WKH FLUFXLWU\ LV FRQWDLQHG RQ D VLQJOH SULQWHG FLUFXLW ERDUG 3&%  DVVHPEO\ZKLFKFRQVLVWVRIWKH3&%SOXVKHDWVLQNDQGEUDFNHW7KLV'63%RDUGDVVHPEO\LVNQRZQDVWKH³'63 FRQWUROOHU´VLQFHD'LJLWDO6LJQDO3URFHVVRU'63 LVDWWKHKHDUWRIDOOWKHFRQWUROIXQFWLRQVRIWKLVERDUG7KHUHDUHWZR versions of DSP controller used on Elevation series treadmills, one for low voltage (100-120 VAC) and another for high YROWDJH9$& LQSXWSRZHU7KHLQSXWSRZHUFRQQHFWRU3DQGWKHOLIWDFWXDWRUFRQQHFWRU3DUHGLIIHUHQWRQ WKHORZDQGKLJKYROWDJH'63FRQWUROOHUVLQRUGHUWRKHOSSUHYHQWLQVWDOOLQJWKHZURQJFRQWUROOHU$QRWKHUGLVWLQJXLVKLQJ feature between the two versions is that FUSE2 and FUSE3 are replaced with jumper wires on the low voltage version VLQFHWKH\DUHRQO\UHTXLUHGIRU(XURSHDQ9$& 2. Input Power 7KHLQSXWSRZHUFRPHVLQIURPWKHOLQHFRUGDWWDFKHGWRDQ,(&FRQQHFWRUDQGLVURXWHGWKURXJKDSRZHUVZLWFK$IWHUWKH VZLWFKDQ(OHFWUR0DJQHWLF,QWHIHUHQFH(0, ¿OWHULVDGGHGWRUHGXFHUDGLRIUHTXHQF\FRQGXFWHGHPLVVLRQV$GLIIHUHQW ¿OWHU LV XVHG RQ PRGHOV PHHWLQJ (XURSHDQ UHTXLUHPHQWV YHUVXV PRGHOV GHVLJQ WR PHHW 86 UHTXLUHPHQWV $ FDEOH DVVHPEO\FRQWDLQLQJWUDQVLHQWVXSSUHVVLRQGHYLFHVFDOOHG029¶VRUPHWDOR[LGHYDULVWRUVLVDWWDFKHGWRWKHOLQH¿OWHU 7KHVHGHYLFHVKHOSSUHYHQWKLJKWUDQVLHQWYROWDJHVSLNHVVXFKDVIURPOLJKWQLQJIURPGDPDJLQJLQWHUQDOFLUFXLWU\7KH SRZHUFDEOHIURPWKH¿OWHUDQG029WKHQJRHVWRFRQQHFWRU3RQWKH'63FRQWUROOHU3LVDWKUHHSRVLWLRQFRQQHFWRU IRU9$&WUHDGPLOOVDQGDWZRSRVLWLRQFRQQHFWRUIRU9$&WUHDGPLOOV 2QWKH'63FRQWUROOHUWKHLQSXWSRZHUJRHVWKURXJKDQLQUXVKOLPLWLQJFLUFXLWDQGDQLQSXWSRZHUUHOD\7KHLQUXVKOLPLWLQJ circuit adds series impedance to limit high peak currents when the large DC bus capacitors are being charged at turn RQ7KHLQSXWSRZHUUHOD\LVSDUWRIWKHHPHUJHQF\VWRSVZLWFKV\VWHPDQGZLOOUHPRYHSRZHUWRWKHPRWRUFRQWUROOHU VWRSSLQJVWULGLQJEHOWPRYHPHQWZKHQWKH(PHUJHQF\6WRS6ZLWFK(66 ODQ\DUGLVSXOOHGE\WKHXVHU%RWKWKHFRQVROH DQGWKH'63KDYHFRQWURORIWKLVUHOD\WRWXUQRIISRZHUWRWKHPRWRUFRQWUROOHU7KHSRZHUVXSSO\UHPDLQVRQDQGWKH FRQVROHZLOOVWLOOEHSRZHUHGZKHQWKLVUHOD\LVRSHQHG 3. Motor Control 7KH$&SRZHULVUHFWL¿HGE\%5ZKLFKLVPRXQWHGWRWKHKHDWVLQNDQG¿OWHUHGE\IRXUODUJHHOHFWURO\WLFFDSDFLWRUV,QWKH FDVHRIWKH9$&ORZYROWDJH'63FRQWUROOHUDYROWDJHGRXEOHUFRQ¿JXUDWLRQLVXVHGVRWKHEXVYROWDJHIRUWKH PRWRUFRQWUROOHULVWKHVDPHIRUERWKKLJKDQGORZYROWDJHYHUVLRQV7KH'&EXVYROWDJHJRHVWRWKH,*%7PRGXOHZKLFK LVPRXQWHGRQWKHKHDWVLQNDQGLVWKHPDLQSRZHUVWDJH7KLVPRGXOHLVFRQ¿JXUHGDVDWKUHHSKDVHEULGJHLQYHUWHU which converts the DC bus voltage to three phase AC voltages at the appropriate amplitude and frequency to run the PRWRUDWWKHFRUUHFWVSHHG7KHPRWRUFRQWUROOHUVHQVHVWKH,*%7EULGJHSKDVHFXUUHQWVDQGXVHVWKLVLQIRUPDWLRQWR FDOFXODWHWKHPRWRUVSHHGVRDVSHHGVHQVRULVQRWUHTXLUHG 4. Lift Control 7KH/LIWDFWXDWRUZKLFKFRQWUROVWUHDGPLOOLQFOLQHLVSRZHUHGIURPWKH'63FRQWUROOHU7KHOLQHYROWDJHLVVZLWFKHGWRHLWKHU WKHLQFOLQHRUGHFOLQHZLQGLQJVRIWKH$&PRWRUGHSHQGLQJRQZKLFKGLUHFWLRQLVFRPPDQGHG7KH'63FRQWUROOHUDOVR UHDGVWKH+RPH6ZLWFKZKLFKWHOOVWKH'63WKHLQFOLQHLVDW7KHRQWLPHRIWKH/LIW0RWRULVFRQWUROOHGWRSURYLGHWKH FRPPDQGHGLQFOLQH$IUHTXHQF\GHWHFWFLUFXLWRQWKH'63FRQWUROOHUGHWHFWVZKHWKHUWKHLQSXW$&OLQHIUHTXHQF\LV +]RU+]DQGDGMXVWVWKHRQWLPHWRREWDLQWKHFRUUHFWLQFOLQH 5. Power Supply 7KH'63FRQWUROOHUFRQWDLQVDÀ\EDFNSRZHUVXSSO\WKDWSRZHUVWKHFRQVROHFLUFXLWU\DVZHOODVDOOFLUFXLWU\RQWKH'63 FRQWUROOHU$À\EDFNSRZHUVXSSO\SURYLGHV9'&DQG9'&WRWKHFRQVROH7KHVHYROWDJHVDUHLVRODWHGIURPWKH$& OLQHYROWDJH7KHVDPHÀ\EDFNVXSSO\DOVRSURYLGHVVXSSO\YROWDJHVWRWKHUHVWRIWKH'63FRQWUROOHU7KHVHYROWDJHVDUH QRWLVRODWHGIURP$&OLQHEXWDUHUHIHUHQFHGWRWKHPRWRUFRQWUROOHUEXVYROWDJH7KHSRZHUVXSSO\LVDXQLYHUVDOLQSXW VXSSO\DQGZLOORSHUDWHIURP9$&WR9$& 24 Modules Base Frame Electronics:Theory of Operation BE 2 M051-00K65-A003 6. Stride Sensor 7KH6WULGHVHQVRULVDSLH]RHOHFWULFVHQVRUSODFHGXQGHUWKHGHFNZKLFKVHQVHVPRYHPHQWRIWKHGHFN7KHYROWDJH coming out of the piezoelectric sensor goes to the DSP controller which has an opto-isolator isolating the stride sensor IURPWKH'637KH'63PRQLWRUVWKLVYROWDJHDQGVHQGVWKHLQIRUPDWLRQWRWKHFRQVROHZKHUHLWLVXVHGWRGHWHUPLQHWKH SUHVHQFHRIDXVHU 7. Console Interface 7KH '63 FRPPXQLFDWHV WR WKH FRQVROH SURFHVVRU YLD D WZR ZLUH VHULDO FRPPXQLFDWLRQV 1RWH -: VKRXOG QRW EH SUHVHQWIRU(OHYDWLRQWUHDGPLOOV2WKHUWUHDGPLOOVZKLFKXVHVLQJOHZLUHFRPPXQLFDWLRQZLOOKDYH-:LQRQWKH'63 FRQWUROOHU 2SWRLVRODWRUVDUHSURYLGHGRQWKH'63FRQWUROOHUWRLVRODWHWKHWUDQVPLWOLQHDQGUHFHLYHOLQHVLQFHWKHJURXQG UHIHUHQFHIRUWKH'63FLUFXLWU\LVQRWWKHVDPHDVWKDWRIWKHFRQVROH'63FRQWUROOHUVRIWZDUHXSGDWHVFDQEHSHUIRUPHG E\XVLQJLW¶VEXLOWLQ¿HOGUHSURJUDPPDELOLW\FDSDELOLW\GLUHFWO\RUYLDWKHFRQVROH&VDIHLQWHUIDFH An additional optically isolated signal the DSP controller receives from the console is the Emergency stop signal which FRQWUROVWKHLQSXWSRZHUUHOD\ 8. DSP Controller Software The Life Fitness motor controller uses proprietary control algorithms to control the ac induction motor to allow for PD[LPXPHI¿FLHQF\QRLVHFRQWURODQGVPRRWKQHVVRYHUWKHIXOOUDQJHRIRSHUDWLRQ Onboard sensors monitor bus voltage, motor current and power module temperature ensuring component limits are not H[FHHGHG /LQHYROWDJHFRPSHQVDWLRQDOORZVZLGHYROWDJHÀXFWXDWLRQVWREHWUDQVSDUHQWWRWKHH[HUFLVHU 0D[LPXPDYHUDJHSRZHULVUHJXODWHGDOORZLQJVKRUWWHUPSHDNVZKLOHVWLOOFRQWUROOLQJDYHUDJHSRZHU Motor Controller diagnostics keep track of 34 parameters and maximums to aid in appraising the health and performance RIWKHV\VWHP7KHVHFRPELQHGZLWKLQGLFDWRU/('¶VKHOSWKHVHUYLFHWHFKQLFLDQGLDJQRVLQJDQGFRUUHFWLQJDQ\V\VWHP LVVXHV A serial communication link between the motor controller and Console provides seamless operation of the whole 7UHDGPLOOV\VWHP 9. Indicators and Displays 7KHUHDUHWHQ/('¶VRQWKH3RODU%RDUG ‡ LED1 12V indicator ‡ LED2 6V indicator ‡ LED3 Tx Communication indicator ‡ LED4 Lift (Up) direction ‡ LED5 Lift ON ‡ LED6 V bus indicator ‡ LED7 +Vd indicator ‡ /(' 9LQGLFDWRU ‡ LED9 Incline 0 position indicator ‡ LED10 Incline Bottom position indicator 25 Modules BE 3 Base Frame Electronics:Theory of Operation M051-00K65-A003 10. Connector &RQQHFWRU3LVDVL[SRVLWLRQIHPDOH0DWH1/RFNFRQQHFWRUIRUPRWRU PIN # DESCRIPTION P1-1 Frame P1-2 Phase W P1-3 Phase V P1-4 Phase U P1-5 Not Used P1-6 Not Used &RQQHFWRU3LVDIRXUSRVLWLRQ0LFUR¿WFRQQHFWRUIRUOLPLWVZLWFKHV PIN # DESCRIPTION P4-1 Zero position switch P4-2 Zero position switch return (GND) P4-3 Bottom limit switch P4-4 Bottom limit switch return (GND) &RQQHFWRU3LVDWHQSRVLWLRQ0LQL¿WMUIRUFRQVROHSRZHUDQGVLJQDOV PIN # DESCRIPTION P5-1 RTN P5-2 RTN P5-3 6VDC (Elevation); 8VDC (Classic) P5-4 6VDC (Elevation); 8VDC (Classic) P5-5 9(OHYDWLRQ 1&&ODVVLF P5-6 5;' P5-7 7;' P5-8 1& P5-9 12VDC P5-10 ESS &RQQHFWRU3LVIRXUSRVLWLRQ0DWH1/RFNFRQQHFWRUIRUOLIWDFWXDWRU PIN # DESCRIPTION P6-1 Down P6-2 Hot P6-3 Up P6-4 1& 26 Modules BE 4 Base Frame Electronics:Theory of Operation M051-00K65-A003 &RQQHFWRU3LVDWKUHHSRVLWLRQ0LQL¿W6HQLRUFRQQHFWRUIRULQSXWSRZHU PIN # DESCRIPTION P7-1 Line P7-2 Neutral P7-3 Not used &RQQHFWRU3LVDSRVLWLRQ0LQL¿W-UIRUPRWRUWKHUPDOVZLWFK PIN # DESCRIPTION P8-1 Therm1 P8-2 Therm2 &RQQHFWRU3LVD¿YHSRVLWLRQ0LQL)LW-UFRQQHFWRUIRUFRQVROHYROWDJHVHOHFW PIN # DESCRIPTION P9-1 8V P9-2 6/8V P9-3 6V P9-4 12V P9-5 12V(ESS) &RQQHFWRU3LVDSRVLWLRQ&JULGFRQQHFWRUIRU6WULGH6HQVRULQWHUIDFH PIN # DESCRIPTION P10-1 RTN P10-2 SSENSE P10-3 +12VDC &RQQHFWRU3SRVLWLRQ..7HVWFRQQHFWRU PIN # DESCRIPTION P14-1 1& P14-2 1&NH\ P14-3 GND P14-4 +Vd (15Vdc) Internal Supply P14-5 9,QWHUQDO6XSSO\ P14-6 Reset 27 Modules BE 5 Base Frame Electronics:System Components M051-00K65-A003 Motor Controller Main Cable Retaining Bracket Line Cord On/Off Switch 28 Modules BE 6 Base Frame Electronics:Problem Symptom Table M051-00K65-A003 SYMPTOM POSSIBLE CAUSE SECTION PAGE No power to treadmill Open or failure in line cord, FDEOHVFRQWUROOHUHWF 6HHÀRZFKDUW %( 8 Maximum speed is reduced RUHUURUPHVVDJH³&DQQRW DWWDLQWDUJHWVSHHG´ ,QVXI¿FLHQWOLQHYROWDJH Refer Stride System 0RGXOH 66 3 Unit resets randomly Or SDXVHV Intermittent in line cables, VWRSVZLWFKFLUFXLW 6HHÀRZFKDUW %( 10 (UURUPHVVDJH³0RGXOH &RPPXQLFDWLRQ(UURU´ Power up Communication test to base failed or lost FRPPXQLFDWLRQZLWKEDVH Check/replace cabling GRZQWRWKH0& Error message ³1RWLI\PDLQWHQDQFH communication timeout PRWRUFRQWUROOHU ´ Broken communication lines, JW3 installed on DSP 0& 5HPRYH-:&KHFN replace cabling down to the 0&9LEUDWLRQLVFDXVLQJ intermittent operation from ORRVHFRQQHFWLRQ (UURUPHVVDJH³1RWLI\ maintenance motor controller error (thermal VKXWGRZQ ´ The M/C compartment DLUÀRZLVUHVWULFWHG+RW DLULVEHLQJEORZQRQLW,W¶V ORFDWHGLQGLUHFWVXQOLJKW There is excessive wear on WKHEHOWRUGHFN Clean the M/C FRPSDUWPHQW,QVXUH adequate ventilation is available and it is not being heated by a heating UHJLVWHU0RYHIURPGLUHFW VXQOLJKW5HSODFHEHOWGHFN LISRZHUOHYHOLVH[FHVVLYH (UURUPHVVDJH³:DUQLQJ – step off belt, maximum YROWDJHWULS´ User is driving the belt with VXI¿FLHQWHQHUJ\WRUDLVH the bus voltage, most likely DWKLJKLQFOLQHV Input line has voltage surge SUREOHPV Instruct the user to stop driving the belt at high inclines, or to use a ORZHULQFOLQH&RQWDFWDQ electrician to diagnose/ correct a power line SUREOHP (UURUPHVVDJH³1RWLI\ maintenance motor controller error (hardware FXUUHQWWULS  Excessive motor current caused by a failed motor, intermittent motor or motor FRQQHFWLRQV  A possible but unlikely cause would be a severely ZRUQEHOWGHFN Verify that all motor connections and cables DUHVROLG,IVWDUWXSSRZHU is very weak a phase may EHIDXOW\3HUIRUPDSKDVH test to verify the system or GLDJQRVHDSKDVHSUREOHP (UURUPHVVDJH³1RWLI\ maintenance Motor controller error (low voltage detected) Line cord is not securely plugged into the wall or PDFKLQH/RRVHLQWHUPLWWHQW UHFHSWDFOHZLULQJ Machine is not plugged into DSURSHUGHGLFDWHGOLQH Incoming voltage is ÀXFWXDWLQJGLSSLQJWRDQ LQVXI¿FLHQWOHYHO Check that the cord is solidly plugged into the wall receptacle and also into the PDFKLQH Contact an electrician to diagnose/correct a power OLQHSUREOHP Worn deck and/or worn VWULGLQJEHOW 29 Modules BE 7 Base Frame Electronics:Problem Symptom Table SYMPTOM POSSIBLE CAUSE SECTION (UURUPHVVDJH³6WDUWXS HUURU´ Motor unplugged or FRQQHFWRUORRVH A possible but unlikely cause would be the user GULYLQJWKHEHOWDWVWDUWXS Verify that the motor FRQQHFWLRQVDUHVROLG Perform a phase test to verify the system or GLDJQRVHDSKDVHSUREOHP (UURUPHVVDJH³0RWRU GLVDEOHG´ An intermittent console/ motor controller cable or HPHUJHQF\VWRSVZLWFK &RQ¿UPWKDWDOOFRQQHFWLRQV are solid, all wires are properly seated into the connector and that the cable is not pinched and EHLQJVKRUWHGRSHQ9HULI\ proper operation of the HPHUJHQF\VWRSVZLWFK (UURUPHVVDJH³,QFOLQH inoperative – continue if GHVLUHG´ Improper home or decline switch operation/ DGMXVWPHQWFDEOH Incline motor connection XQSOXJJHGORRVH A possible but unlikely cause would be incline motor overheating from H[FHVVLYHRSHUDWLRQ Verify that all motor and switch connections and FDEOHVDUHVROLG Verify incline switch operation using diagnostic VZLWFK/('6/('   Verify incline motor activation using diagnostic /('6/('  Re-adjust or replace switches/ FDEOHV Line cord inoperative Damaged &KHFNFRQQHFWLRQV Not connected 5HSODFHOLQHFRUG Damaged 5HSODFHPDLQFDEOH Main cable inoperative M051-00K65-A003 PAGE Not connected Motor controller inoperative Damaged Replace motor controller ERDUG Not connected On/Off switch inoperative Damaged 5HSODFH2Q2IIVZLWFK Not connected /LQH¿OWHULQRSHUDWLYH Damaged 5HSODFHOLQH¿OWHU Not connected IEC receptacle in inoperative Damaged 5HSODFH,(&UHFHSWDFOH Not connected 30 Modules BE 8 Base Frame Electronics:Troubleshooting Flow Diagrams M051-00K65-A003 No Power on Treadmill Start Measure line voltage at outlet Line voltage at outlet ok? No voltage at outlet Switch the treadmill to other outlet Seated property? No Reseating the line cord Line cord is ok? No Replace line cord Power switch ok? No voltage at TP1 Replace power switch /LQH¿OWHURN" No voltage at TP2 Replace line ¿OWHU Main cable harness ok? No Replace main cable harness Are LEDs illuminating? No Replace motor controller Yes Check line cord at outlet and receptacle at treadmill Yes Inspect line cord Yes Check power switch Yes Check main cable harness Yes Check DSP controller Yes Check line ¿OWHU Yes 7HVWWRFRQ¿UP ¿[ 31 Modules BE 9 Base Frame Electronics:Troubleshooting Flow Diagrams M051-00K65-A003 Reduce Maximum Speed Start Worn belt or deck? Measure line voltage at outlet Yes No Perform belt/ GHFNWHVW Excess power indicated? Yes Replace belt, ÀLSWKHGHFNLI QHFHVVDU\ ,QVXI¿FLHQW voltage? Yes Problem with incoming line power or not a dedicated line No Check line voltage No Heavy users at high speed OK with lighter weight users? No It is normal for high speed use to degrade DVEHOWDJHV Belt and deck may needs to be changed frequently in clubs where there is VLJQL¿FDQWXVDJH by heavier users DWKLJKVSHHGV 7HVWWRFRQ¿UP ¿[ 32 Modules BE 10 Base Frame Electronics:Troubleshooting Flow Diagrams M051-00K65-A003 Treadmill Pauses or Reset Randomly Start Check whether the treadmill is on a dedicated line On dedicated line? No Connect to a dedicated line, see manual No Properly seat the power cord No Replace the power cord No Replace the stop switch Check power cord at outlet Seated properly? Yes Check ground prong on power cord Ground ok on cord? Yes Check stop switch Triggering is ok? Yes Check display console connection Connection is ok? No Inspect, then tighten tthe connection Yes Yes Check main cable harness Damaged or shorted cable? Test the cable with multimeter, replace it when QHFHVVDU\ No 7HVWWRFRQ¿UP ¿[ 33 Modules BE 11 Base Frame Electronics:How To’s M051-00K65-A003 REPLACEMENT OF LINE CORD  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  /LIWWKHIURQWHQGRIWKHWUHDGPLOODSSUR[LPDWHO\LQFKHVRIIWKHÀRRU  DQGSODFHDEORFNRIZRRGXQGHUQHDWKERWKVLGHVWRVXSSRUWLW  Remove and save the two screws that secure the line cord retaining  EUDFNHWWRWKHPRWRUSDQ  8QSOXJWKHGHIHFWLYHOLQHFRUG  Install the new line cord, using the screws removed and saved in  6WHS Retaining Bracket Line Cord REPLACEMENT OF MAIN CABLE  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  5HPRYHWKHWRSPRWRUFRYHU6ee /)   5HPRYHWKH$FWLYLW\=RQHDVVHPEO\6ee CA 22   5HPRYHWKHORZHUEULGJHFRYHU6ee 8)   'LVFRQQHFWRQHHQGRIWKHPDLQFDEOHIURPWKHPRWRUFRQWUROOHU  Disconnect the cable between the top of the left upright and the  FRQVROH  3XOOWKHPDLQFDEOHRXWRIWKHOHIWXSULJKW  ,QVWDOOWKHQHZPDLQFDEOH Main Cable 12-18 lb*in >NJ FP@ Added torque 34 Modules Base Frame Electronics:How To’s BE 12 M051-00K65-A003 REPLACEMENT OF MOTOR CONTROLLER (DSP)  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  5HPRYHWKHWRSPRWRUFRYHU6ee/)   5HFRUGWKHFDEOHFRQQHFWLRQORFDWLRQV  5HPRYHWKHORZHUEULGJHFRYHU6ee8)   Loosen the three hex nuts that secure the motor controller to the PRWRUSDQ  Remove and save the two bolts that secure the motor controller EUDFNHWWRWKH/LIW0RWRUEUDFNHW  5HPRYHWKHPRWRUFRQWUROOHU  Install the new motor controller using hardware saved in the SUHYLRXVVWHSV Recommended Tools:  3KLOOLSVVFUHZGULYHUPPVRFNHWORQJó´H[WHQVLRQó´UDWFKHW Motor Controller Motor Pan Hex Nut 12-18 lb*in >NJ FP@ 35 Modules BE 13 Base Frame Electronics:How To’s M051-00K65-A003 REPLACEMENT OF THE ON/OFF SWITCH  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  5HPRYHWKHWRSPRWRUFRYHU6ee LF 3   5HFRUGWKHORFDWLRQRIZLUHFRQQHFWLRQVWRWKHRQRIIVZLWFK  'LVFRQQHFWWKHZLUHV8VHQHHGOHQRVHSOLHUVLIQHFHVVDU\NJ FP@ 36 Modules BE 14 Base Frame Electronics:How To’s M051-00K65-A003 REPLACEMENT OF IEC RECEPTACLE  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  /LIWWKHHQGRIWKHWUHDGPLOODERXWIRXULQFKHVRIIWKHÀRRUDQGSODFH  EORFNVRIZRRGXQGHUERWKVLGHVWRVXSSRUWLW  Remove and save the two screws that secure the line cord retaining  EUDFNHWWRWKHPRWRUSDQ6HWWKHUHWDLQLQJEUDFNHWDVLGH  8QSOXJWKHOLQHFRUGIRUPWKHXQLWDQGVDYH  5HPRYHWKHWRSPRWRUVKURXGFRYHU6ee LF 3   5HPRYHWKHPRWRUFRQWUROOHU 12-18 lb*in >NJ FP@ IEC Receptacle 37 Modules BE 15 Base Frame Electronics:Electrical Wiring Diagrams M051-00K65-A003 DSP Controller Block Diagram DSP Controller Stride Sensor Console Piezo-Electric Stride Sensor Opto-isolated Interface Power Supply Digital Signal Processor (DSP) 3 Phase AC Induction Motor Controller 4HP AC Motor Incline Switch(s) EMI Filter Emergency Stop Relay Inrush Limiting Circuit 5HFWL¿HU%XV Capacitor Lift Actuator Control Circuit Lift Actuator Power Switch Line AC Power High Voltage Low Voltage Isolated Low Voltage Control 38 Modules BE 16 Base Frame Electronics:Electrical Wiring Diagrams M051-00K65-A003 DSP Controller Functional Description /('9'& LED9: VD JW10 on P17 Welded Frame:In Classic Frame:Out P4: Home SW LED 9 & 10 P7: AC Input 120V: 3POS 230V: 2POS P10: Stride Sensor Relay 2 AC Input Power Rly P9: PS Jumper LED: 8V & 12V LCD: 6V & 12V P5: Console Cable &RQVROH3RZHU &RPPXQLFDWLRQ (PHQJHQF\6WRS LED1:12VDC LED2: 6V OR 8V LED3: Communication JW3: Communication Jumper Elevation: Out Classic: In IGBT Module (underneath board) P1 Motor Plug P8: Motor Thermal Switch Low Voltage Power SupplyTransformer LED 6 DC Bus Voltage P6: Actuator 120V:4POS 230V:3POS DC Bus Capacitor LED 4 & 5 Lift Up & Down Inrush Limiter Fuses present on high voltage boards only 39 Modules Base Frame Electronics:Electrical Wiring Diagrams BE 17 M051-00K65-A003 Base Electronics Wiring Diagram 40 Modules Lift System: Theory of Operation LS 1 M051-00K65-A003 7KH/LIW0RWRU6\VWHPLVFRPSULVHGRIWKH/LIW0RWRUWKHOLIWIUDPHDQGWKH+RPH6ZLWFKVHHSDJH/6 In order for the lift system to be operational, the Emergency Stop Switch located on the console area must be properly HQJDJHG7KH/LIW0RWRULVSLQQHGWRWKH/LIW0RWRUVXSSRUWEUDFNHWRQWKHWUHDGPLOOIUDPHRQRQHHQGDQGLVSLQQHGRQWKH RWKHUHQGWRWKHOLIWIUDPH7KH/LIW)UDPHLVDOVRSLQQHGWRWKHWUHDGPLOOIUDPHVHHSDJH/6 7KH/LIW0RWRUFRQVLVWVRIDJHDUER[DVWHHO$&0(VFUHZDQGDVWHHOWXEH7KHVWHHOWXEHKDVDQHQJLQHHUHGSODVWLFQXW WKDWLV¿[HGRQRQHHQGRIWKHWXEH7KH$&0(VFUHZLVSLQQHGWRWKHRXWSXWJHDURQWKHJHDUER[RQRQHHQGDQGVFUHZV LQWRWKHQXWRQWKHVWHHOWXEHRQWKHRWKHUHQG$VWKH$&0(VFUHZURWDWHVWKHVWHHOWXEHH[WHQGVRUUHWUDFWVZKLFKUDLVHV RUORZHUVWKHWUHDGPLOO7KHUHDUHLQWHUQDOOLPLWVVZLWFKHVRQWKHJHDUER[WRSUHYHQWRYHUWUDYHO 7KH/LIW0RWRULVSURJUDPPHGWRLQFOLQHWKHWUHDGPLOOXSWRDWLQFUHPHQWV7KHGHVLUHGLQFOLQHLVFRPPDQGHG WKURXJKWKHLQFOLQHXSRUGRZQDUURZVRUWKURXJKWKHNH\SDGRQWKHFRQVROH:KHQDXVHU¿UVWVWDUWVWKHWUHDGPLOOWKH/LIW Motor will lower the treadmill until the Home Switch is activated (this is 0% incline or level) unless the treadmill is already DWLQFOLQH,IWKH+RPH6ZLWFKFDQQRWEHDFWLYDWHGWKHFRQVROHZLOOGLVSOD\DPHVVDJHDIWHUDJLYHQGXUDWLRQVWDWLQJ ³LQFOLQHLQRSHUDWLYHFRQWLQXHLIGHVLUHG´ One way of determining if a Lift Motor or a Home Switch is electrically defective is by observing whether or not certain /('¶VRQWKHPRWRUFRQWUROOHUOLJKWXS6LPLODUO\NQRZLQJWKDWERWKWKH/LIW0RWRUDQGWKH+RPH6ZLWFKDUHHOHFWULFDOO\JRRG and the LED’s do light up but the treadmill is not able to be inclined or lowered may be an indication that the Lift Motor is PHFKDQLFDOO\GHIHFWLYHRUWKHFRQWUROOHULVEDG7KHVHWHVWVDUHGHVFULEHGLQGHWDLOLQWKH%DVH(OHFWURQLFV%( VHFWLRQ 41 Modules LS 2 Lift System: System Components M051-00K65-A003 Cross-section View Of Lift System (-01 And -02 Models Only) Clevis Pin Frame Tie Bar Lift Motor Support Bracket Lift Motor Home Switch Lift Frame Bolt, Nut, Washer (2 Places) (16-20 ft-lbs) >1P@ Lift Motor Tube Wheel and E-Ring (2 places) Bolt, Nut, Washer (2), Nut (4-8 ft-lbs) >1P@ Cross-section View Of Lift System (-03 Models And Higher) Lift Motor Support Bracket 42 Modules Lift System: System Components LS 3 M051-00K65-A003 Lift System (-01 And -02 Models Only) Tie Bar Bolt, Flat Washer, Split Washer (4 places) (5-9 ft-lbs) >1P@ Nut, Flat Washer (3 places) (9-13 ft-lbs) >1P@ Bolt, Flat Washer (2 places) (25-36 ft-lbs) >1P@ Lift Motor Support Bracket Clevis Pan Frame Tie Bar Frame Tie 1HYHUUHPRYHWKLV Lift System (-03 Models And Higher) Lift Motor Support Bracket 43 Modules LS 4 Lift System: Problem Symptom Table M051-00K65-A003 SYMPTOM POSSIBLE CAUSE SECTION PAGE Lift Motor does not raise or ORZHUXQLW Broken internal components in Lift Motor gear box (motor runs but $&0(VFUHZGRHVQRW 5HSODFH/LIW0RWRU LS 6 Thermal cutout switch open due to overheating of /LIW0RWRU Allow Lift Motor to cool for PLQXWHVDQGFRQ¿UP proper operation, Otherwise replace Lift 0RWRU LS 6 Broken/worn plastic nut on Lift Motor tube (ACME screw rotates but does not UDLVHXQLW  5HSODFH/LIW0RWRU LS 6 Failed clevis pin or failed PRXQWLQJEROW Replace mounting bolt or FOHYLVSLQ LS 6 Emergency stop switch is UHPRYHG Install emergency stop VZLWFK Motor controller lift circuit IDLOXUH Perform test on motor FRQWUROOHUDQG/(' and replace Lift Motor if /('¶VGRQRWOLJKWXS 8QLWFDQQRW¿QG+RPH Switch due to improper installation which causes Lift Motor to bottom out before activating Home 6ZLWFK Remove and re-install Lift Motor at proper extended OHQJWK LS 6 Home Switch not FRQQHFWHG Connect Home Switch FDEOH LS 9 )DXOW\+RPH6ZLWFK When Home Switch is manually pressed the /('RQWKHFRQWUROOHU VKRXOGEH21,IQRWFKHFN cable and replace Home 6ZLWFKLIUHTXLUHG LS 9 Lift Motor does not raise XQLW 44 Modules LS 5 Lift System: Problem Symptom Table M051-00K65-A003 SYMPTOM POSSIBLE CAUSE SECTION PAGE Lift Motor operates LQWHUPLWWHQWO\ 2YHUKHDWLQJRI/LIW0RWRU 5HSODFH/LIW0RWRU LS 6 Broken internal components in Lift Motor gear box (ACME screw rotates intermittently while PRWRULVUXQQLQJ  Allow Lift Motor to cool for PLQXWHVDQGFRQ¿UP proper operation, Otherwise replace Lift 0RWRU LS 6 Failed clevis pin or mounting bolt causing Lift 0RWRUWRVLWDWDQDQJOH Inspect clevis pin and PRXQWLQJEROW /LIWIUDPHZKHHOVÀDWWHQHG due to wear or broken or FUDFNHG 5HSODFHZKHHOV 'LI¿FXOWWRPRYHXQLWZLWK OLIWIUDPHZKHHOV 45 Modules LS 6 Lift System: How To’s M051-00K65-A003 REMOVAL OF LIFT MOTOR  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII Tie Bar on -01 and -02 models only  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  'LVFRQQHFW/LIW0RWRUFRQQHFWRUIURPPRWRUFRQWUROOHU  5HPRYH)UDPH7LH%DUDQGPRGHOVRQO\  NOTE: Do not remove any other frame brackets  'LVFRQQHFW/LIW0RWRUJURXQGZLUH  7XUQXQLWRQLWVVLGH Ground Screw (12-18 in-lbs) >1P@  5HPRYH/LIW0RWRUORZHUSLYRWKDUGZDUH (4-8 ft-lbs) >1P@ 46 Modules LS 7 Lift System: How To’s M051-00K65-A003  5HPRYH&OHYLV3LQ5HPRYH/LIWPRWRU  ,QVWDOOQHZ/LIW0RWRUDQGKROGLQSODFHZLWK&OHYLV3LQ Clevis Pin Align hole in Lift Motor Tube with pivot hole in lift frame so that +RPH6ZLWFKLVDFWXDWHG/LVWHQIHHOIRUDFWXDWLRQRI+RPH6ZLWFK Home Switch Lift Motor Lower Pivot  ,QVWDOO/LIW0RWRUORZHUSLYRWKDUGZDUH 7XUQXQLWXSULJKW Connect ground wire and plug in Lift Motor connector to motor FRQWUROOHU 3RZHUXSXQLWDQGWHVWWUDYHO D  :KHQXQLWLVSRZHUHGXSXQLWPXVW¿QG+RPH6ZLWFKDQGWKHQ  VWRS E  &RPPDQGLQFOLQHDQGZDLWXQWLOLQFOLQLQJVWRSV'HSUHVV  +RPH6ZLWFK8QLWVKRXOGLQFOLQHPRPHQWDULO\DQGTXLFNO\VWRS If this occurs, the Lift Motor has reached its internal limit switch  DQGLVRSHUDWLQJSURSHUO\,IXQLWGRHVQRWLQFOLQHPRPHQWDULO\ implies that internal limit switch was reached before unit was  DEOHWRUHDFKLQFOLQH Go back to Step 10 and adjust Lift Motor tube pivot to lift frame pivot by turning Lift Motor tube clockwise and repeat above  WHVWVWHSV (4-8 ft-lbs) >1P@ 47 Modules LS 8 Lift System: How To’s M051-00K65-A003 REMOVAL OF LIFT FRAME  7XUQXQLWRQLWVVLGHDQGOD\DJDLQVWXSULJKWIUDPH  5HPRYH/LIW0RWRUORZHUSLYRWKDUGZDUH  5HPRYH/LIW)UDPHSLYRWKDUGZDUH  5HPRYH(5LQJWRUHPRYHZKHHOV  ,QVWDOOQHZOLIWIUDPH Lift Motor Lower Pivot Lift Frame Pivot Lift Frame for -03 and higher Lift Frame for -01 and -02 Models Lift Frame Pivot Bushing Lift Motor Lower Pivot Wheel E-Ring Lift Frame Pivot for -03 and higher Lift Frame Pivot for -01 and -02 Models (16-20 ft-lbs) >1P@ (4-8 ft-lbs) >1P@ (16-20 ft-lbs) >1P@ (4-8 ft-lbs) >1P@ 48 Modules LS 9 Lift System: How To’s REMOVAL OF HOME SWITCH (FOR -01 AND -02 MODELS)  2SHUDWHLQFOLQHDQGUDLVHXQLWWRSHUFHQWLQFOLQH  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  5HPRYHWRSPRWRUFRYHU M051-00K65-A003 Tie Bar bolt, ÀDWZDVKHU split washer (4 places) (5-9 ft-lbs) >1P@ Frame Tie Bar  5HPRYH)UDPH7LH%DU Nut, Flat washer (3 places) (9-13 ft-lbs) >1P@ %ROWÀDWZDVKHU (2 places) (25-36 ft-lbs) >1P@  5HPRYHEUDFNHWZLWK+RPH6ZLWFK  Remove cable from Home Switch leads Nut (2 places) (25-34 in-lbs) >NJFP@  5HPRYH+RPH6ZLWFKE\SXVKLQJRQWDEV  Install new Home Switch in bracket and connect cable to Home 6ZLWFKOHDGV  Install Home Switch with bracket to treadmill frame  ,QVWDOO)UDPH7LH%DU Tabs on Home Switch 49 Modules Lift System: How To’s REMOVAL OF HOME SWITCH (FOR -03 AND HIGHER)  2SHUDWHLQFOLQHDQGUDLVHXQLWWRSHUFHQWLQFOLQH LS 10 M051-00K65-A003 Home Switch  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  5HPRYHWRSPRWRUFRYHU  'LVFRQQHFWFDEOHIURP+RPH6ZLWFKOHDGV  Push on Home Switch tabs and push switch down and out to UHPRYH  ,QVWDOOQHZ+RPH6ZLWFKDQGFRQQHFWFDEOH Home Switch 50 Modules CA 1 Console & Activity Zone: Theory of Operation M051-00K65-A003 GENERAL CONSOLE 7KH/&'HTXLSSHGDQGLQFK HOHYDWLRQVHULHVFRQVROHVVKDUHDORWRIWKHVDPHEDVLFIXQFWLRQDOLW\ The console provides all user interface functions, user workout programs, entertainment processing, and control messages WRWKHEDVH7KHDFWLYLW\]RQHLVIXQFWLRQDOO\DSDUWRIWKHFRQVROHWKHNH\SDGDQGHPHUJHQF\VWRSDUHGLUHFWO\ZLUHGWRWKH FRQVROHPDFKLQHLQWHUIDFHERDUG 7- and 15-inch Differences 7KHLQFK/&'DNDWKHLFRQVROH DQGWKHLQFK/&'DNDWKHHFRQVROH FRQWUROWKHPDFKLQHLQVLPLODUZD\VEXW KDYHGLIIHUHQWHQWHUWDLQPHQWDQGXVHULQWHUIDFHLPSOHPHQWDWLRQV 7KH³H´LQFK/&' GHSHQGVVROHO\RQ/&'WRXFKVFUHHQ³VRIWEXWWRQV´IRUXVHULQSXWV,WDOVRLQFOXGHVDQDQDORJ79WXQHU ZKLFKKDVDEXLOWLQL3RG$XWKHQWLFDWLRQ&RSURFHVVRU 7KH³L´LQFK/&' KDVDNH\SDGWKDWVXUURXQGVWKHVFUHHQ6LQFHWKHDQDORJWXQHUERDUGLVQRWSUHVHQWLQWKHLQFK FRQVROHL3RG$XWKHQWLFDWLRQ&RSURFHVVRULVSODFHGRQWKHVHSDUDWHERDUG 15-inch LCD 7-inch LCD This picture shows the printed circuit boards used in WKHSURGXFWLRQLQFK/&'WUHDGPLOOFRQVROH This picture shows the printed circuit boards mounted in WKHSURGXFWLRQLQFK/&'WUHDGPLOOFRQVROH 51 Modules Console & Activity Zone: Theory of Operation CA 2 M051-00K65-A003 SBC THEORY OF OPERATION 7KHUHDUHWZRW\SHVRIWKH6%&2QHZRUNVZLWKWKHLQFKGLVSOD\6%&L WKHRWKHURQHZLWKWKHLQFKGLVSOD\6%&H  1RWHWKDWWKHWZRPRGXOHVDUHQRWLQWHUFKDQJHDEOH The SBC-i is responsible for the following functions:  &RPPXQLFDWLRQWR0,%  &RQWUROWKHLQFK/&' %DFNOLJKWIRU/&'  7RXFKVFUHHQFRQWUROOHU  3URYLGH9GFDQG9GFIRUDOO3&%V  6XSSRUW86%FRPPXQLFDWLRQZLWKWKH86%FKDUJLQJ  6XSSRUWL3RG® (communication with the iPod®, audio / video input, charging)  5HFHLYH$XGLRLQSXWVIURP$WWDFKDEOH79L3RG®, Virtual Trainer)  3URYLGH$XGLRRXWSXWWRKHDGSKRQHV  ,QWHUIDFHZLWK$SSOH$XWKHQWLFDWLRQ3&% ,QWHUIDFHZLWK$WWDFKDEOH79UHFHLYHDXGLRLVVXHFRPPDQGVURXWHL3RG® video to TV) The SBC-e is responsible for the following functions:  Communication to MIB  &RQWUROWKHLQFK/&' %DFNOLJKWIRU/&'  7RXFKVFUHHQFRQWUROOHU  *HQHUDWH9'&DQG9'&IRUDOO3&%V  6XSSRUW86%FRPPXQLFDWLRQFKDUJLQJ  6XSSRUWL3RG® (communication, audio / video input, charging)  5HFHLYH$XGLRLQSXWVIURP7XQHUL3RG®, Virtual Trainer)  3URYLGH$XGLRRXWSXWWRKHDGSKRQHV  ,QWHUIDFHWR$QDORJ7XQHUZ$SSOH$XWKHQWLFDWLRQ *HQHUDWH&ORVHG&DSWLRQ  ,PSOHPHQWKDUGZDUHIRU(WKHUQHWFRQQHFWLYLW\IXWXUHIXQFWLRQDOLW\QRWVXSSRUWHGE\VRIWZDUH 52 Modules Console & Activity Zone: Theory of Operation CA 3 M051-00K65-A003 MIB THEORY OF OPERATION 7KHUHLVRQO\RQHNLQGRIWKH0,%,WZRUNVZLWKERWKWKHDQGWKHLQFKGLVSOD\V The functions of the MIB include: 3URFHVV/LIH3XOVH® (LP) Heart Rate signal from sensors 5HFHLYH7HOHPHWU\3RODU +HDUW5DWHVLJQDO &DOFXODWH+HDUW5DWH/3 3RODU ,QWHUIDFHWRPHPEUDQHVZLWFKNH\SDG 5HVSRQGWR(PHUJHQF\6WRS6ZLWFK 5HGXQGDQW&6$)(SRUWVIRU6HULDO&RPPRUDFFHVVRU\SRZHU 6HULDO&RPP9'& WR*%&0& 6HULDO&RPP9'& WR6%& 3URYLGH%DWWHU\9ROWDJHVZLWFKIRU1RUPDO2SHUDWLRQ 3URYLGH%DWWHU\9ROWDJHVZLWFKIRU6OHHS0RGH 'ULYHVSHDNHUPRQRWRQHEHHS /RZVLGHGULYHIRUDOO/('V 'ULYHWKH/('VRIWKH'DWD'LVSOD\DQG.H\SDG *HQHUDWH,5FRPPDQGVIRUDWWDFKDEOH79 DATA DISPLAY THEORY OF OPERATION (USED ON THE 7-INCH LCD ONLY) 3URYLGHVVHJPHQWGLVSOD\VWRFUHDWHGDWD¿HOGVRIQXPHUDOV'ULYHVDOO/('V ANALOG TUNER THEORY OF OPERATION The functions provided by the tuner are: Right angle adapter to convert F-connector to RCA, Receive NTSC or PAL/SECAM Analog video via RCA input Implement NTSC or PAL/SECAM Tuner, Provide Audio and Video outputs to SBC-e, Implement I2C for Apple Authentication co-processor 53 Modules Console & Activity Zone: Theory of Operation CA 4 M051-00K65-A003 APPLE AUTHENTICATION THEORY OF OPERATION This board allows for positive authentication of Apple devices like iPod® and iPhone® (collectively known as an i-product) in RUGHUWRDFFHVVDXGLRDQGYLGHRSOD\OLVWV This functionality is implement via an I2C communication between the i-product, the SBC, and the authentication coSURFHVVRU HEADPHONE ESD PRINTED CIRCUIT BOARD This board protects the Single Board Computer (SBC) board from Electrostatic Discharges (ESD) that may reach the SBC YLDWKHKHDGSKRQHMDFN LIFEPULSE ESD PRINTED CIRCUIT BOARD This board protects the Machine Interface Board (MIB) from Electrostatic Discharge (ESD) that may reach the board via /LIH3XOVHVHQVRULQSXWV CODED RECEIVER 7KLVERDUGUHFHLYHV7HOHPHWU\+HDUW5DWHSXOVHVIURPFKHVWVWUDS7KLVERDUGLPSOHPHQWVYDULDEOHJDLQFRQWUROWRHQVXUH FRGHGRSHUDWLRQZLWKWKHLQWHQGHGWUDQVPLWWHU BACKLIGHT INVERTER (7-INCH LCD) This board converts 12VDCto more than 500 VAC for the back light known as the Cold Cathode Flourescent Light (CCFL) OLJKW BACKLIGHT INVERTER (15-INCH LCD) This board converts 12VDC to more than 500 Vac for the back light known as the Cold Cathode Flourescent Light (CCFL) OLJKW 54 Modules Console & Activity Zone: System Components CA 5 M051-00K65-A003 Activity Zone Emergency Stop Switch 55 Modules Console & Activity Zone: System Components CA 6 M051-00K65-A003 15-INCH LCD CONSOLE SYSTEM COMPONENT 7-INCH LCD CONSOLE SYSTEM COMPONENT 56 Modules Console & Activity Zone: System Components CA 7 M051-00K65-A003 ACTIVITY ZONE Mounting Screws Accessible from Rear Trail from Keypad Emergency Stop Reed Switch Mounting Bracket POLAR TELEMETRY BOARD 57 Modules CA 8 Console & Activity Zone: Problem Symptom Table M051-00K65-A003 CONSOLE SYMPTOM POSSIBLE CAUSE SECTION No power to console No power to base Check that there is power at the outlet, breaker and VZLWFKDOO2. Faulty main cable or bad cable connection Check +12VDC at Pins 11 and 12 of main cable that JRHVWR0,%5HSODFHFDEOH LIQHFHVVDU\ Faulty main cable Check for power to FRQVROH Defective SBC 5HSODFH6%& Defective LCD screen 5HSODFH/&'SDQHO Defective inverter Test inverter – replace if QHFHVVDU\ Defective SBC 5HSODFH6%& Defective backlights 5HSODFH/&'SDQHO Touchscreen needs calibration &DOLEUDWHWRXFKVFUHHQ Defective LCD touchscreen 5HSODFHWKHWRXFKVFUHHQ Touchscreen does not respond Defective LCD touchscreen 5HSODFHWKHWRXFKVFUHHQ Safety key not seated properly 5HVHDWVDIHW\NH\ Snow and noise appear on screen Air / cable setting incorrect Change setup to proper VHWWLQJ Defective coax – no signal 9HULI\VLJQDOSUHVHQW Defective tuner board 5HSODFHWXQHUERDUG Air / cable setting incorrect Change setup to proper VHWWLQJ Defective coax – no signal defective 9HULI\VLJQDOSUHVHQW Touchscreen needs calibration &DOLEUDWHWRXFKVFUHHQ Defective LCD touchscreen 5HSODFHWRXFKVFUHHQ Defective SBC 5HSODFH6%& Defective MIB 5HSODFH0,% Defective analog tuner 5HSODFHWXQHU No audio, screen does not turn on No backlight, screen is dark Touchscreen not accurate Unable to receive cable channels Channels do not change PAGE 58 Modules CA 9 Console & Activity Zone: Problem Symptom Table M051-00K65-A003 CONSOLE SYMPTOM POSSIBLE CAUSE SECTION Sound does not change Touchscreen needs calibration Calibrate touchscreen Defective MIB Replace MIB Air/Cable setting incorrect Change setup to proper setting Defective headphones Try different headphones Defective headphone jack or cable Inspect and replace as DSSURSULDWH Defective iPod® cable on option panel Replace option panel Defective iPod® Verify iPod® function Defective tuner board – $XWKHQWLFDWLRQIDLOV Replace tuner board Ghost HR – on engage treads power cable routing, or receiver too sensitive, happened with early SURGXFWLRQQRQFRGHG Non updated cable being used, frame not properly grounded, early non-coded UHFHLYHULQVWDOOHG Cable should be AK65$RUODWHU See service Bulletin on IUDPHJURXQGLQJ,QVWDOO FRGHGUHFHLYHU Emergency stop not working MIB defective, magnet misplaced in holder Check that the magnet is properly located in the SODVWLFKROGHU5HSODFH0,% LIFDEOHDQGPDJQHWJRRG Video lockup Old revision of tuner and / or SBC Try tuner revision F or later, if still bad then try SBC UHYLVLRQ(RUODWHU Distorted audio Option panel not updated Install latest revision option SDQHO Headphone jack loose Option panel not updated ,QVWDOOODWHVWRSWLRQSDQHO iPod® not charging Defective iPod® cable or connection from option panel to MIB, option panel not updated Check cable and connections, replace, repair DVDSSURSULDWH,QVWDOOODWHVW UHYLVLRQRSWLRQSDQHO Console does not recognize USB memory drive inserted into FRQQHFWRU Defective USB drive or connector / cable / connection Verify functionality of USB GULYH&KHFNFDEOHDQG connections, replace, repair DVDSSURSULDWH No sound L3RGGRHVQRWZRUN PAGE 59 Modules CA 10 Console & Activity Zone: Problem Symptom Table M051-00K65-A003 ACTIVITY ZONE SYMPTOM POSSIBLE CAUSE SECTION PAGE Buttons not registering Damage &KHFNFRQQHFWLRQV CA 22 Not Connected 5HSODFH$FWLYLW\=RQH Need to replace Activity =RQH Damage 5HSODFH$FWLYLW\=RQH CA 22 Need to replace console QHFNVSDFHU Damage Replace console neck VSDFHU CA 23 Console inoperative Misconnection 5HSODFHFRQVROH CA 23 5HSODFHFRQVROHFRYHU CA 24 &RVPHWLFÀDZV &RVPHWLFÀDZV Damaged Rear console cover UHTXLUHVUHSODFHPHQW Damage Cosmetic Flaws 60 Modules CA 11 Console & Activity Zone: Troubleshooting Flow Diagrams M051-00K65-A003 NO POWER START &KHFNHPHUJHQF\VWRS Magnet in place? No Replace magnet Base powered up? No Troubleshoot Base (OHFWURQLFV Power present on cable connector? No 5HSODFH&DEOH Beeps heard on power-up? No Replace 6%& Yes Remove cover to reveal motor FRQWUROERDUG Yes Check main cable to MIB for SRZHU Yes Replace 0,% &KDQJH/&'SDQHO Finished 61 Modules CA 12 Console & Activity Zone: Troubleshooting Flow Diagrams M051-00K65-A003 TV NOT WORKING START Verify that air/cable setting is FRUUHFW Video OK but no TV? No 6HHEDGYLGHR Signal good at Tuner? No Replace cable, adapter or UHSDLUVRXUFH Coax jumper in place if required? No Replace or reconnect coax jumper cable between SBC DQGWXQHUERDUG Recheck function TV still bad? No Finished Recheck function TV still bad? No Done - reinstall analog tuner ERDUGLWZDVSUREDEO\2. Recheck function TV still bad? No 'RQH5HLQVWDOODQDORJ tuner and SBC7KH\ZHUH SUREDEO\2. Yes Verify that television signal is JRRGDWWXQHU Yes Verify that coax jumper is in place between tuner board and SBC LQVLGHFRQVROHLIHTXLSSHG  Yes 5HSODFHDQDORJWXQHUERDUG Yes Replace 6%& Yes 5HSODFH/&' 5HSODFHFRQVROH 62 Modules CA 13 Console & Activity Zone: Troubleshooting Flow Diagrams M051-00K65-A003 NO VIDEO ON LCD START Look for power from base or other signs of life, audio beeps or LED lighted Does console have power? No Repair no power problem Does keypad or touch screen function? No Replace SBC Video working? No Replace console Noise in good earphones? No 5HSODFHGHIHFWLYHHDUSKRQHV Both noisy? No TV only noisy > replace tuner board VT/ iPod® only noisy > replace 6%& No Finished Yes Check for other machine functions - for example, keypads or touch screen function Yes Replace LCD panel Yes Finished DISTORTION / NOISE IN AUDIO START Try a fully functional pair of HDUSKRQHV Yes Switch between TV audio, VT audio and iPod® audio Yes Install new option panel Still noisy? Yes Replace 92353 Polar Board or replace cables (Hd Ph ext) or option panel SBCFDEOH 63 Modules CA 14 Console & Activity Zone: Troubleshooting Flow Diagrams M051-00K65-A003 TELEMETRY HR NOT WORKING Check manager’s settings in GLDJQRVWLFV START Telemetry HR enabled in Manager’s settings? No Change settings to enable telemetry HR Produce HR signal with Polar Simulator Correct HR shown on HR test page? Yes Finished Replace telemetry UHFHLYHU Correct HR shown on HR test page? Yes Finished Replace cable between receiver and FRQVROH Correct HR shown on HR test page? Yes Finished Replace 0,% Correct HR shown on HR test page? Yes Finished Correct HR shown on HR test page? No Unexpected error, contact /) Yes No Replace AE wiring MIB S/B AK65-000430001 Rev Activity Zone or ODWHU Correct HR? No No Yes Done No 9HULI\¿[ grounding through frame DQGDWFRQVROH Correct HR? No No Yes Done Reposition telemetry UHFHLYHU Yes Finished 64 Modules CA 15 Console & Activity Zone: Troubleshooting Flow Diagrams M051-00K65-A003 KEYPAD NOT RESPONDING Check emergency VWRSPDJQHW START In place? No Replace Run GLDJQRVWLFV Passes keypad test? Yes Finished Replace NH\SDG Passes keypad test? Yes Finished Replace 0,% Passes keypad test? Yes Finished Yes Isolate between console keypad or $FWLYLW\=RQHNH\SDG No Yes Just Activity Zone keypad BAD? Yes No Just console keypad BAD? No 9HULI\¿[NH\SDG connected inside $FWLYLW\=RQH Yes 8QH[SHFWHGHUURUFRQWDFW/) 3DVVNH\SDGWHVW No Yes Done TIP: All hard keys (keypads) are connected to and processed by the MIBERDUG$Q\WLPHDNH\LVSUHVVHGWKHMIB will LVVXHDFRQ¿UPDWLRQµEHHS¶XQOHVVWKH&OXEKDVWXUQHG2IIµ6\VWHP6RXQGV¶LQ0DQDJHU¶V&RQ¿JXUDWLRQ 65 Modules CA 16 Console & Activity Zone: Troubleshooting Flow Diagrams M051-00K65-A003 LIFEPULSE® HR NOT WORKING START Open Heart Rate Test in Diagnostic, place left hand on FRQWDFWV Left hand-on indicated in Diagnostic screen? No 6ZDSVHQVRUFDEOHV Right hand-on indicated? No Replace cable Correct HR shown on HR test page? Yes Finished Correct HR shown on test page? Yes Finished Correct HR shown on test page? Yes Finished Yes 3ODFHULJKWKDQGRQ Yes 3ODFHERWKKDQGVRQ No Replace cable between UHFHLYHUDQGFRQVROH No Replace 0,% No 8QH[SHFWHGHUURUFRQWDFW/) 66 Modules CA 17 Console & Activity Zone: Troubleshooting Flow Diagrams M051-00K65-A003 LCD SCREEN IMAGES ARE DIM/DARK Look for dim images on screen QREDFNOLJKW  START Dim images present? Reposition CCFL inverter input FDEOHDZD\IURPLQYHUWHU Yes No Done Video good? Yes No 5HSODFH&&)/LQYHUWHUFDEOH Video good? Yes No Done Replace 6%& No 5HSODFH/&'SDQHO iPod® works in RWKHUPDFKLQHV No Problem in iPod® iPod® works? Yes Finished iPod® works? Yes Finished iPod® works? Yes Finished Video good now? Yes Finished iPod® DOES NOT WORK START If possible try iPod® in another PDFKLQH Yes Change option panel and FDEOHV No &KDQJHWXQHUERDUG No Change 6%& No 8QH[SHFWHGHUURUFRQWDFW/) 67 Modules CA 18 Console & Activity Zone: Troubleshooting Flow Diagrams M051-00K65-A003 TOUCH SCREEN NOT RESPONDING START ,QVHUW86%GULYHZLWKVRIWZDUH Console boots to software install SDJH No Replace 6%& Enters calibration routine? No 5HSODFHWRXFKVFUHHQ Touch screen calibration terminate successfully? No Repeat calibration, slowly and carefully, press and hold; wait IRUFXUVRUWRPRYH Yes Touch Calibrate Touch Screen ODUJHEXWWRQ Yes Re-insert USB drive and try again to calibrate touch VFUHHQ Yes Finished Yes Calibration successful? No 8QH[SHFWHGHUURUFRQWDFW/) 68 Modules CA 19 Console & Activity Zone: Troubleshooting Flow Diagrams M051-00K65-A003 CHANNELS DO NOT CHANGE START Check touch screen FDOLEUDWLRQ Calibrates VXFFHVVIXOO\ No 5HSODFHWRXFKVFUHHQ Channels Change? Yes Finished Channels Change? Yes Finished Channels Change? Yes Finished Yes 5HSODFHWXQHUERDUG No Replace 6%& No Replace 0,% No 8QH[SHFWHGHUURUFRQWDFW/) 69 Modules CA 20 Console & Activity Zone: Troubleshooting Flow Diagrams M051-00K65-A003 AUDIO DOES NOT CHANGE START Check touch screen FDOLEUDWLRQ Calibrates VXFFHVVIXOO\ No 5HSODFHWRXFKVFUHHQ Audio Changes? Yes Finished Audio Changes? Yes Finished Audio Changes? Yes Finished Yes 5HSODFHWXQHUERDUG No Replace 6%& No Replace 0,% No 8QH[SHFWHGHUURUFRQWDFW/) 70 Modules CA 21 Console & Activity Zone: Troubleshooting Flow Diagrams M051-00K65-A003 USB DRIVE NOT RECOGNIZED START ,QVHUW86%'ULYH Software update screen appears? Yes Finished Drive good? No 5HSODFHGULYH Software update screen appears? Yes Finished Software update screen appears? Yes Finished No 9HULI\WKDW86%GULYHLVJRRG Yes Replace option panel or cable between SBC and option SDQHO No Replace 6%& No 8QH[SHFWHGHUURUFRQWDFW/) 71 Modules Console & Activity Zone: How To’s REPLACEMENT OF ACTIVITY ZONE  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII CA 22 M051-00K65-A003 Bezel Access Door  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  Remove the bezel access located on the bottom of the lower bridge FRYHU  Remove and save the two bolts that secure the Activity Zone DVVHPEO\WRWKHEULGJHZHOGPHQW8VHDÀDVKOLJKWWRORFDWHWKH EROWV Screws  'LVFRQQHFWWKHFDEOHFRQQHFWLRQVWRWKH$FWLYLW\=RQH  5HPRYHWKH$FWLYLW\=RQHDVVHPEO\  Install the new Activity Zone assembly, using the bolts and saved in 6WHS 72 Modules CA 23 Console & Activity Zone: How To’s REPLACEMENT OF CONSOLE NECK SPACER  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  5HPRYHWKHUHDUFRQVROHFRYHU  5HPRYHWKHFRQVROHDVVHPEO\ M051-00K65-A003 Neck Spacer Screws (2) Torque to LQ OE >NJ FP@ Console Bracket Console Neck Spacer  Remove and save the two Allen bolt heads that secure the console QHFNVSDFHUWRWKHFRQVROHPRXQWLQJEUDFNHW  5HPRYHWKHFRQVROHQHFNVSDFHU  ,QVWDOOWKHQHZFRQVROHQHFNVSDFHUXVLQJWKHEROWVVDYHGLQ6WHS REPLACEMENT OF THE CONSOLE ASSEMBLY  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  5HPRYHWKHUHDUFRQVROHFRYHU  Remove and save the four Phillips screws that secure the console DVVHPEO\WRWKHFRXQVROHPRXQWLQJEUDFNHW Console Console Bracket Console Mounting Screws (4) Rear Console Cover  'LVFRQQHFWDOOFDEOHVWRWKHFRQVROHDVVHPEO\  ,QVWDOOWKHQHZFRQVROHDVVHPEO\XVLQJWKHVFUHZVVDYHGLQ6WHS Rear Console Cover Screws (2) Torque to LQ OE >NJ FP@ 73 Modules CA 24 Console & Activity Zone: How To’s M051-00K65-A003 REPLACEMENT OF REAR CONSOLE COVER Rear Console Cover Screws (2)  Remove and save the two Allen screws that secure the rear console FRYHUWRWKHFRQVROHPRXQWLQJEUDFNHW  5HPRYHWKHUHDUFRQVROHFRYHU  ,QVWDOOWKHQHZUHDUFRQVROHFRYHUXVLQJWKHVFUHZVVDYHGLQ6WHS Rear Console Cover Torque to LQ OE >NJ FP@ REPLACEMENT OF OPTION PANEL  8VLQJD3KLOOLSVVFUHZGULYHUUHPRYHWKHWZRVFUHZVWKDWVHFXUH WKHRSWLRQSDQHO6DYHWKHVHVFUHZV  *HQWO\SXOOFRQQHFWRUWKURXJK)URQW3ODVWLFV  Disconnect the headphone, USB and iPod®FRQQHFWLRQV  ,QVWDOOQHZRSWLRQSDQHODQGYHULI\DOOFRQQHFWLRQV Optional Panel Mounting Screws Option Panel Assembly 74 Modules Console & Activity Zone: Electrical Wiring Diagrams CA 25 M051-00K65-A003 BLOCK DIAGRAM - 15 INCH CONSOLE BLOCK DIAGRAM - 7 INCH CONSOLE 75 Modules Console & Activity Zone: Electrical Wiring Diagrams CA 26 M051-00K65-A003 76 Modules HR 1 Heart Rate System: Lifepulse Theory of Operation ® M051-00K65-A003 The LifePulse® contact heart rate system is designed to sense the electrical signals originating from the heart as it beats and, XVLQJVRIWZDUHFRPSXWHDQGGLVSOD\WKHFRUUHVSRQGLQJKHDUWUDWHYDOXHRQWKHFRQVROHUHDGRXW7KHWZRSDLUVRIHOHFWURGHV on the Treadmill Ergo bar (left and right) are the point of contact at which these signals are picked up and transmitted from the body to the LifePulse®FLUFXLWU\$KDQGVRQGHWHFWFLUFXLWPRQLWRUVIRUDFKDQJHLQYROWDJHFRUUHVSRQGLQJWRWKHLQSXW IRUHDFKRIWKHOHIWDQGULJKWVHQVRUSDLUVWRGHWHUPLQHLIHLWKHURUERWKDUHEHLQJKHOG%RWKVHQVRUVPXVWEHKHOGLQRUGHU IRUWKHHOHFWULFDOVLJQDOIURPWKHKHDUWWREHPHDVXUHG7KLVLVVLPLODUWRPHDVXULQJWKHYROWDJHRIDEDWWHU\ZLWKDYROWPHWHU In order to measure a battery the voltmeter must be connected across the battery terminals (one lead to the positive and RQHOHDGWRWKHQHJDWLYH 6LPLODUO\WKHKHDUWFDQEHWKRXJKWRIDVDYROWDJHVRXUFHRUEDWWHU\DQGLQRUGHUWRPHDVXUHLW¶V YROWDJH\RXPXVWPHDVXUHDFURVVLWVWHUPLQDOV(VVHQWLDOO\ZKHQWKHOHIWDQGULJKWVHQVRUVDUHKHOGWKH\DFWOLNHWKHOHDGV RIWKHYROWPHWHU6LQFHDQHOHFWULFDOSDWKH[LVWVIURPWKHHOHFWURGHVKHOGLQRQHKDQGXSWKHDUPDFURVVWKHERG\DQGWKH KHDUW GRZQWKHRWKHUDUPDQGLQWRWKHRWKHUKDQGKROGLQJWKHRWKHUSDLURIHOHFWURGHVDYROWDJHFDQEHPHDVXUHG7KLVLV how the LifePulse®VLJQDOLVPHDVXUHG$QGMXVWOLNHPHDVXULQJDEDWWHU\WKHSRODULW\RIWKHYROWDJHLVLPSRUWDQWVRWKHOHIW DQGULJKWHOHFWURGHVPXVWFRUUHVSRQGWRWKHOHIWDQGULJKWXVHUKDQGV To pick up the heart signal LifePulse®PXVWXVHDYHU\VHQVLWLYHKLJKJDLQGLIIHUHQWLDODPSOL¿HU7KLVLVSULPDULO\GXHWRWKH signal’s initial low amplitude as it originates from the heart (typically less than 2 millivolts peak to peak) and the resultant DWWHQXDWLRQRUVLJQDOGURSDVLWWUDYHOVWKURXJKWKHERG\DQGLQWRWKHHOHFWURGHV7KLVW\SHRIDPSOL¿HULVGLIIHUHQWIURP D UHJXODU DPSOL¿HU LQ WKDW RQO\ WKH GLIIHUHQFHV EHWZHHQ WKH LQSXWV DUH DPSOL¿HG ,Q WKLV ZD\ FRPPRQ VLJQDOV W\SLFDOO\ HOHFWULFDOQRLVHDSSHDULQJRQERWKLQSXWVFDQEHVLPXOWDQHRXVO\LJQRUHGZKLOHWKHGLIIHUHQFHVDUHDPSOL¿HG 7KHRXWSXWRIWKLVKLJKJDLQGLIIHUHQWLDODPSOL¿HUZKHQQHLWKHURURQO\RQHHOHFWURGHSDLULVKHOGLVPHDQLQJOHVVEHFDXVH WKHLQSXWVWRWKHDPSOL¿HUEDVLFDOO\DFWDVDQWHQQDSLFNLQJXSDQGDPSOLI\LQJVWUD\HOHFWULFDOVLJQDOVIURPWKHHQYLURQPHQW ,GHDOO\RQFHERWKHOHFWURGHSDLUVDUHKHOGDVGHWHFWHGE\WKHKDQGVRQFLUFXLWU\WKHKHDUWVLJQDOFDQEHLVRODWHGDPSOL¿HG DQGSUHVHQWHGWRWKHVRIWZDUHIRUDQDO\VLV,QSUDFWLFHKRZHYHUDGGLWLRQDOXQZDQWHGVLJQDOVH[LVW6RPHRIWKHVHVLJQDOV FRPHIURPRWKHUPXVFOHVZKLFKOD\DORQJWKH³YROWDJH´SDWKWRWKHKHDUWEHLQJPHDVXUHGVXFKDVDUPDQGFKHVWPXVFOHV  Similarly, hand to electrode contact problems which tend to weaken the signal or even introduce new signals which hide WKHDFWXDOKHDUWVLJQDOFDQRFFXU7KH/LIH3XOVH® software attempts to isolate just the heart signal from all other unwanted VLJQDOVDQGQRLVHXVLQJFRPSOH[VRIWZDUHWHFKQLTXHV Basically, the LifePulse®VRIWZDUHVDPSOHVWKHDPSOL¿HGVLJQDOSLFNHGXSDWWKHHOHFWURGHVPDQ\WLPHVDVHFRQGORRNLQJ IRUWKHKHDUWSXOVHV'HSHQGLQJXSRQWKHDPRXQWRIQRLVHVL]HRIVLJQDODQGRULUUHJXODULW\RIWKHKHDUWSXOVHLWPD\WDNH PDQ\VHFRQGVIURPWRRUPRUH WRFRQ¿GHQWO\GHWHUPLQHDYDOXH$QGLIDYDOXHFDQQRWEHFRQ¿GHQWO\GHWHUPLQHG DKHDUWUDWHZLOOQRWEHGLVSOD\HG7RLQFUHDVHWKHGHWHFWLRQRIDKHDUWVLJQDOWKH/LIH3XOVH® software attempts to expand WKHVDPSOHGVLJQDOWRPD[LPL]HWKHLPSRUWDQWIHDWXUHV$*DLQYDOXHZKLFKUHSUHVHQWVWKHUHODWLYHDPRXQWWKHVLJQDOZDV expanded is displayed in the LifePulse®GLDJQRVWLFVFUHHQDQGFDQUDQJHIURPWR$QDVVHVVPHQWRIWKHVWUHQJWKRIWKH VLJQDOFDQEHGLUHFWO\UHODWHGWRWKLVJDLQYDOXH Input signals already at maximum levels require a low gain because their features cannot be further expanded without ORVLQJLQIRUPDWLRQ9HU\ZHDNVLJQDOVUHTXLUHPRUHJDLQWKXVH[SDQGLQJWKHPWRIXOOVFDOHVRWKHLUIHDWXUHVFDQEHHDVLO\ SLFNHGRXW7KLVVFDOLQJLVGRQHG\QDPLFDOO\RYHUFRQVHFXWLYHEORFNVRIVDPSOHVZLWKHDFKJDLQFRPSXWHGUHODWLYHWRWKH KLJKHVWVLJQDOFRPSRQHQWZLWKLQWKDWEORFN7KHVWUHQJWKRIWKHVLJQDOGHWHUPLQHVWKHHIIHFWLYHQHVVRIWKHVFDOLQJ ,QJHQHUDOZHDNVLJQDOVDUHOHVVGHVLUDEOHWKDQVWURQJRQHVDQGYHU\VWURQJVLJQDOVDUHOHVVGHVLUDEOHWKDQZHDNHURQHV Obviously, weak signals requiring high gain values means that the weak heart pulses will be competing with other low level EDFNJURXQGQRLVHZKHQERWKDUHVFDOHGXSPDNLQJLWKDUGWRGHWHUPLQHWKHKHDUWVLJQDOIURPWKHEDFNJURXQGVLJQDOV2Q the other hand, strong signals, usually not from the heart pulse itself, will ultimately limit the amount of scaling that can be DSSOLHG7\SLFDOJDLQYDOXHVIRUORZQRLVHVLJQDOVZKLFKSURGXFHJRRG/LIH3XOVH® heart rates are generally between 10 and $ERYHPHDQVWKHKHDUWVLJQDOLVZHDNHUDQGEHORZPHDQVRWKHUQRLVHVLJQDOVDUHWRRVWURQJWKXVRYHUSRZHULQJ WKH KHDUW SXOVHV -XVW DV WKH JDLQ YDOXH LQGLFDWHV WKH VWUHQJWK RI WKH KHDUW VLJQDO WKH &RQ¿GHQFH QXPEHU LQGLFDWHV WKH TXDOLW\RIWKHKHDUWUDWHUHDGLQJZKHQRQHLVGLVSOD\HG 77 Modules HR 2 Heart Rate System: Lifepulse Theory of Operation ® M051-00K65-A003 The LifePulse® VRIWZDUH XVHV PDQ\ PHWKRGV WR DQDO\]H WKH KHDUW VLJQDO DQG ]HUR LQ RQ WKH KHDUW UDWH UHDGLQJ 7KH &RQ¿GHQFHQXPEHUZKLFKLVDOVRGLVSOD\HGLQWKH/LIH3XOVH® diagnostic display indicates the agreement in the computed KHDUWUDWHQXPEHUDPRQJWKHVHGLIIHUHQWPHWKRGVDQGWKHUHIRUHWKHFRQ¿GHQFHWKHKHDUWUDWHGLVSOD\HGLVFRUUHFW7KLVLV important when Cardio workouts, which change the load based on the difference between the current and target heart rates, DUHXVHG,IDFRQ¿GHQWKHDUWUDWHFDQQRWEHGHWHUPLQHG&DUGLRZRUNRXWSURJUDPVFDQQRWDXWRPDWLFDOO\DGMXVWWKHORDGWR UHDFKWKHWDUJHWKHDUWUDWH&RQ¿GHQFHYDOXHVFDQUDQJHIURPWRZLWKEHLQJWKHOHDVWFRQ¿GHQWUHDGLQJDQGEHLQJ WKHPRVWFRQ¿GHQW&DUGLRSURJUDPORDGFKDQJHVRFFXUZKHQKHDUWUDWHUHDGLQJVKDYHFRQ¿GHQFHYDOXHVRIRUKLJKHU Some factors which affect LifePulse®’s ability to determine a heart rate: ‡ Hand slip and/or grip pressure changes on electrodes This can produce noise spikes which drives up gain values and lowers the ability to detect the features of the actual heart pulses. ‡ Dry and/or calloused hands This can further reduce the already low amplitude heart signal picked up from the hands by the electrodes. ‡ Dirty and/or contaminated hands This can also reduce the signal being measured. ‡ Amount of upper body movement 7KLVFDQDGGVLJQDOVZKLFKPXVWEHHYDOXDWHGDQG¿OWHUHGRXWLQWKHVRIWZDUH6RPHWLPHVWKHVHVLJQDOVFDQEHUHJXODU enough to look like heart pulses. ‡ Individual’s own heart pulse amplitude Other noise signals compete with the low heart signals. ‡ Irregular heart rhythms Missing, skipped or irregular heart beats require longer sample times to compute. 78 Modules HR 3 Heart Rate System: System Components Electrodes M051-00K65-A003 Polar Board (hidden from view-within Bottom shroud assembly) View of Polar on Bottom Shroud Polar Board in bottom shroud assembly 79 Modules HR 4 Heart Rate System: Problem Symptom Table M051-00K65-A003 SYMPTOM POSSIBLE CAUSE SECTION PAGE Heart rate system inoperative Damage Check connections HR 5 Not connected Replace heart rate sensors Polar issues Inadequate grounding &RVPHWLFÀDZV Replace Polar Board assembly No/erratic heart rate No/erratic heart rate diagnostic Ghost heart rate Ghost heart rate diagnostic Heart symbol displayed without hands on Hardware diagnostics screening HR 6 80 Modules HR 5 Heart Rate System: How To’s M051-00K65-A003 REPLACEMENT OF HEART RATE SENSORS  Remove and save the two Phillips screws that secure each set of UDWHHOHFWURGHVWRWKH(UJREDU  Note which wires go to the top electrode and which go to the ERWWRPHOHFWURGH  'LVFRQQHFWWKHZLUHVIURPERWKHOHFWURGHV  3OXJWKHZLUHVLQWRWKHQHZHOHFWURGHV  Position the electrode gaskets between the electrodes and the Ergo EDU3OHDVHQRWHWKDWVRPH(UJREDUJDVNHWVDUHDGKHUHGWRWKH (UJREDUV$ODWHUGHVLJQFKDQJH   Install the new electrodes in the Ergo bar, using the screws UHPRYHGDQGVDYHGLQ6WHS  Test the unit to verify that the new electrodes are working properly E\RSHUDWLQJWKHKHDUWUDWHV\VWHP Upper Gasket Upper Heart Rate Assembly Ergo bar Lower Gasket Lower Heart Rate Assembly Phillips Screws (2) Torque to LQ OE >NJ FP@ 81 Modules HR 6 Heart Rate System: How To’s REPLACEMENT OF POLAR BOARD ASSEMBLY  5HPRYH$FWLYLW\=RQH6ee CA 22   5HPRYHWKHERWWRPVKURXG6ee UF 4   5HPRYHUHSODFHERDUGDQGWDSH M051-00K65-A003 Board is taped to bottom of this shroud Bridge Weldment  5HSODFHERWWRPVKURXG  5HSODFH$FWLYLW\=RQH Allen Screws (10) Torque to LQ OE >NJ FP@ Lower Bridge Cover Upright Bolt Heads (2 on each side) Non-coded Polar Board Receiver Coded Polar Board Receiver Please be statically grounded when hanGOLQJWKH3ULQWHG&LUFXLW%RDUGHJDQWL VWDWLFZULVWEDQG  82 Modules Stride (Walking) System:Theory of Operation SS 1 M051-00K65-A003 The Stride System is comprised of the striding belt, the deck, the belt barrier, the Life Spring suspension components, the IURQWDQGUHDUUROOHUVWKHUHDUUROOHUJXDUGVDQGWKHVWULGHVHQVRUDVVHPEO\VHHSDJH66  7KHVWULGLQJEHOWLVLPSUHJQDWHGZLWKDOXEULFDQW7KHGHFNLVDOVRFRDWHGZLWKDSDUDI¿QZD[RQERWKIDFHV7KLVFRPELQDWLRQ DOORZVIRUORZIULFWLRQEHWZHHQWKHVWULGLQJEHOWDQGWKHGHFNZKLFKUHVXOWVLQLQFUHDVHGEHOWGHFNOLIH7KHVWULGLQJEHOWDQG GHFN DUH ZHDU LWHPV DQG ZKHQ WKH IULFWLRQ EHFRPHV ODUJH HQRXJK WKH XVHU PD\ H[SHULHQFH VSHHG VORZGRZQV 7KLV VORZGRZQLVDQLQGLFDWLRQWKDWWKHEHOWDQGGHFNQHHGWREHUHSODFHG7KHGHFNPD\EHÀLSSHGRYHULILWKDVQHYHUEHHQ ÀLSSHGSUHYLRXVO\,QDGGLWLRQWKHFRQVROHPD\GLVSOD\WKHPHVVDJH³81$%/(72$77$,17$5*(763(('´ 7KHVWULGLQJEHOWLVLQLWLDOO\WHQVLRQHGDQGFHQWHUHGDERXWWKHUROOHUVDWWKHIDFWRU\7KHVWULGLQJEHOWPD\KDYHWREHUH FHQWHUHG DW WKH FXVWRPHU VLWH GXULQJ LQVWDOODWLRQ EHFDXVH RI FXVWRPHU ÀRRU LUUHJXODULWLHV 7KHVH LUUHJXODULWLHV PD\ DOVR UHTXLUHWKHOHYHOLQJRIWKHWUHDGPLOOE\DGMXVWLQJWKHUHDUOHYHOHUIHHW7KHFHQWHULQJDGMXVWPHQWLVGRQHYLDWZRDGMXVWLQJ VFUHZVDWWKHUHDUUROOHU:LWKQRUPDOXVDJHWKHVWULGLQJEHOWVWUHWFKHVRYHUWLPHZKLFKPD\FDXVHWKHIURQWUROOHUWRVOLS 7KLVLVDQLQGLFDWLRQWKDWWKHVWULGLQJEHOWKDVWREHUHWHQVLRQHG5HWHQVLRQLQJLVGRQHE\WXUQLQJWKHDGMXVWLQJVFUHZV$ VLPSOHPHWKRGRIGHWHUPLQLQJLIDEHOWLVORRVHLVWKHPSKVWDOOWHVW7KLVWHVWUHTXLUHVWKHWUHDGPLOOWRUXQDWPSKDQG the technician stomps hard on the striding belt to try to stall the motor while observing whether the front roller spins when WKHVWULGLQJEHOWPRPHQWDULO\VWRSV During treadmill use and depending how a user runs on the treadmill, the striding belt may move to either side causing the EHOWWRJRRIIFHQWHU7RDLGZLWKWKLVWKHIURQWDQGUHDUUROOHUVDUHWDSHUHGDWWKHHQGV7KLVIHDWXUHKHOSVWKHVWULGLQJEHOW FHQWHULWVHOIGXULQJXVH,QDGGLWLRQWKHWUHDGPLOOIUDPHKDVEHOWJXLGHVDWHDFKVLGHNQRZQDVEHOWEDUULHUV7KHSXUSRVHRI WKHEHOWEDUULHUVLVWRFRQWDLQWKHVWULGLQJEHOWIURPZDONLQJRIIWKHHGJHRIWKHUROOHUVDQGEHLQJGDPDJHGGXULQJXVH 7KHVWULGLQJEHOWKDVD/LIH)LWQHVVORJRRQWKHHGJHRIHDFKVLGHZKLFKLGHQWL¿HVWKHEHOWDVDQDXWKHQWLF/LIH)LWQHVVSDUW The purpose of the logo is a visual warning that indicates whether the striding belt is moving in the event that a user gets RIIWKHWUHDGPLOOGXULQJWKHZRUNRXWDQGGRHVQRWSUHVVWKHVWRSEXWWRQWRHQGWKHZRUNRXW,QRUGHUWRPLQLPL]HKRZORQJ DXQLWLVUXQQLQJZLWKRXWDXVHURQLWWKHUHLVDVHQVRUZKLFKVHQVHVGHFNPRYHPHQW,WLVORFDWHGRQWKHWUHDGPLOOIUDPH XQGHUWKHGHFN7KLVLVWKH6WULGH6HQVRUDVVHPEO\'HFNPRYHPHQWVDUHVHQVHGE\WKHVWULGHVHQVRUDVVHPEO\ZKLFKDUH FRQYHUWHGWRYROWDJHVLJQDOVDQGVHQWWRWKHFRQWUROOHU,IWKHUHDUHQRGHFNPRYHPHQWVWKHFRQWUROOHUVHQGVDVLJQDOWRWKH FRQVROHLQGLFDWLQJWKHDEVHQFHRIDXVHUWRHQGWKHZRUNRXW The Life Spring suspension system is comprised of a set of eight proprietary elastomers that work in combination with the GHFNWRUHGXFHVWUHVVWRERQHVDQGMRLQWVE\DEVRUELQJVRPHRIWKHLPSDFWORDGVDVVRFLDWHGZLWKUXQQLQJ 83 Modules SS 2 Stride (Walking) System:System Components Roller Guard (both sides) LifeSpring (8 places) Stride Sensor M051-00K65-A003 Belt Barrier Rear Roller Front Roller Assembly Belt Tensioning/ Centering Screw (both sides) Striding Belt (cutaway) Deck (cutaway) 84 Modules SS 3 Stride (Walking) System:Problem Symptom Table M051-00K65-A003 SYMPTOM POSSIBLE CAUSE SECTION PAGE Selected or maximum speed is reduced during ZRUNRXW ,QVXI¿FLHQWOLQHYROWDJH current at the outlet due to unit plugged into a shared QRQGHGLFDWHG RXWOHW Unplug the treadmill and carefully open outlet cover and count number of conductors going to RXWOHW,IWKHUHDUHPRUH than three wires on a single RXWOHWRUPRUHWKDQ¿YH wires on a dual outlet the RXWOHWLVDVKDUHGRXWOHW Unit must be plugged into DGHGLFDWHGRXWOHW6HH operation manual for power UHTXLUHPHQWV N/A Worn deck and/or worn VWULGLQJEHOW 6HWXQLWWRLQFOLQH While standing on striding belt close to the Ergo EDUSXVKRII(UJREDU,I steady, continuous sliding occurs down the incline, the belt/deck wear is DFFHSWDEOH,IVOLGLQJLVQRW continuous replace striding EHOWDQGGHFNRUÀLSGHFN if deck has never been ÀLSSHGEHIRUH  SS 8 'ULYHPRWRUELQGLQJ Check drive motor shaft IRUELQGLQJRUURXJKQHVV 5HSODFHPRWRULIQHFHVVDU\ DS 3 )URQWRUUHDUUROOHUELQGLQJ Inspect rollers for binding RUURXJKQHVV5HSODFHLI QHFHVVDU\ SS 6 Incorrect striding belt WHQVLRQ Do the two mph stall test by stomping on the striding EHOWKDUGDWWZRPSK,IWKH front roller spins when the striding belt momentarily stops the belt tension must EHLQFUHDVHG SS 8 6WULGLQJEHOWVOLSV 85 Modules SS 4 Stride (Walking) System:Troubleshooting M051-00K65-A003 SYMPTOM POSSIBLE CAUSE SECTION Striding belt not centered or traveling close to roller HGJHV 7UHDGPLOOQRWOHYHO Level treadmill by adjusting WKHOHJOHYHOHUV Striding belt not within belt EDUULHUV Position striding belt inside belt barrier on both sides of WKHIUDPH SS 8 Striding belt not tracking properly (belt is off to the OHIWRUWKHULJKW  Adjust the tracking of VWULGLQJEHOW SS 8 :RUQVWULGLQJEHOW SS 8 6HWXQLWWRLQFOLQH While standing on striding belt close to the Ergo bar SXVKRII(UJREDU,IVWHDG\ continuous sliding occurs down the incline, the belt/ GHFNZHDULVDFFHSWDEOH If sliding is not continuous replace striding belt and GHFNRUÀLSGHFNLIGHFN KDVQHYHUEHHQÀLSSHG EHIRUH  *ULQGLQJQRLVHRQIRRWIDOO Excessive friction between GHFNDQGVWULGLQJEHOW SS 8 6HWXQLWWRLQFOLQH While standing on striding belt close to the Ergo bar SXVKRII(UJREDU,IVWHDG\ continuous sliding occurs down the incline, the belt/ GHFNZHDULVDFFHSWDEOH If sliding is not continuous replace striding belt and GHFNRUÀLSGHFNLIGHFN KDVQHYHUEHHQÀLSSHG EHIRUH  Squeaking noise when VWULGLQJEHOWPRYHV Worn or damaged main PRWRUGULYHEHOW Inspect the main drive belt for damage or wear and UHSODFHLIQHFHVVDU\ Drive motor pulley and front UROOHUSXOOH\PLVDOLJQHG Align pulleys as described LQGULYHPRWRUPRGXOH Striding belt not positioned properly between the belt EDUULHU Position striding belt edges WREHEHWZHHQEHOWEDUULHU Striding belt not centered and off to the left or to the ULJKW &HQWHUVWULGLQJEHOW Rubbing sound from under the treadmill when striding EHOWLVPRYLQJ PAGE DS 3 86 Modules SS 5 Stride (Walking) System:Troubleshooting M051-00K65-A003 SYMPTOM POSSIBLE CAUSE SECTION Knocking noise 7UHDGPLOOQRWOHYHO Level treadmill by adjusting WKHOHJOHYHOHUV Faulty front and/or rear UROOHUEHDULQJV Inspect rollers for binding RUURXJKQHVV5HSODFHLI QHFHVVDU\ Lifesprings incorrectly positioned and/or have ORRVHPRXQWLQJKDUGZDUH Inspect lifesprings and mounting hardware and UHSRVLWLRQRUWLJKWHQ Physical damage to stride VHQVRU Check stride sensor for physical damage and replace stride sensor if QHFHVVDU\ Stride sensor not sensing XVHU Go into diagnostics and check stride sensor RSHUDWLRQ Treadmill goes into pause PRGHGXULQJZRUNRXW PAGE 87 Modules SS 6 Stride (Walking) System:How To’s M051-00K65-A003 REMOVAL OF FRONT AND REAR ROLLER  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  Remove motor cover and rear end caps (See LF 3)  5HPRYHUHDUHQGFDSV End Cap Screws (25-35in-lbs) >NJFP@  Remove rear roller guards Roller Guard Screws (25-35in-lbs) >NJFP@  /RRVHQZDONLQJEHOWE\WXUQLQJWHQVLRQLQJVFUHZVFRXQWHUFORFNZLVH Count the number of turns to remove the screw This will simplify reWHQVLRQLQJWKHVWULGLQJEHOWWRWKHVDPHWHQVLRQ Plastic grommet (nut) typical Tensioning screw and washer 88 Modules SS 7 Stride (Walking) System:How To’s M051-00K65-A003  5HPRYHUHDUUROOHU Rear Roller Striding Belt  Remove drive belt from motor pulley (See DS 3) and walk GULYHEHOWRIIRIIURQWUROOHUSXOOH\  Remove front roller mounting bolt and washers and slide front roller towards the left until roller shaft isclear off the mounting hole in IUDPH Front Roller Bolt, Washer, Flat Washer IWOEV >1P@  5HPRYHIURQWUROOHUDVVHPEO\IURPULJKWVLGH Screw, split ZDVKHUÀDWZDVKHU (69-73 in-lbs) >NJFP@ 89 Modules SS 8 Stride (Walking) System:How To’s REMOVAL & INSTALLATION OF STRIDING BELT AND DECK  With the front and rear rollers and other components removed as described in the previous section remove the 4 deck screws and UHPRYHWKHGHFNIURPEHWZHHQWKHEHOW M051-00K65-A003 Deck Screw at 4 corners (25-35in-lbs) >NJFP@ CAUTION: Be careful not to damage the stride sensor with the GHFN  5HPRYHVWULGLQJEHOW CAUTION: Be careful not to damage the stride sensor when UHPRYLQJWKHVWULGLQJEHOW Be Careful Not To Damage Stride 6HQVRU:KHQ5HPRYLQJ'HFN  ,QVWDOOQHZ7LQQHUPDQFOLSVRQWKHFRUQHU/LIH6SULQJV NOTE: Proper assembly Deck Screw at 4 corners (25-35in-lbs) >NJFP@ Bent Corner of Tinnerman Clip 90 Modules SS 9 Stride (Walking) System:How To’s  To install new striding belt, place new belt with arrow on belt SRLQWLQJLQWKHGLUHFWLRQRIEHOWWUDYHO M051-00K65-A003 Front Roller Mounting Bolt, Lock Washer, Flat Washer Striding Belt Deck Screws (4)  Scrape off any wax build up on the front roller surface using a plastic spatula Rear Roller  ,QVWDOOIURQWUROOHUDVVHPEO\ZLWKGULYHEHOWRYHUUROOHUSXOOH\7LJKWHQ PRXQWLQJEROWWRIWOEV>1P@ Deck  Scrape off any wax build up on the rear roller using a plastic spatula Belt Barrier Front Roller Rear Roller Adjusting Screws (2)  Position rear roller through striding belt and let it rest on rear roller EUDFNHWV Rear Roller Striding Belt  Insert new deck through the striding belt and place on the /LIH6SULQJVFDUHIXOO\ZLWKRXWGDPDJLQJWKHVWULGHVHQVRU([LVWLQJ GHFNPD\EHÀLSSHGLILWKDVQHYHUEHHQÀLSSHGEHIRUH CAUTION:&OHDQXQGHUVLGHRIGHFNRIDQ\GHEULVLIEHLQJÀLSSHG Striding Belt Deck 91 Modules Stride (Walking) System:How To’s SS 10 M051-00K65-A003  6HFXUHWKHGHFNZLWKGHFNVFUHZV/LQHXSKROHVLQGHFNZLWK 7LQQHUPDQFOLSKROHV3XVKGRZQRQGHFNDQGLQVWDOOVFUHZ CAUTION: Apply light pressure on screw to avoid bending the Tinnerman clip Orientation of deck with cutout facing the rear Deck screw at 4 corners LQOEV >NJFP@  Center the striding belt about the front and rear rollers at DSSUR[LPDWHO\òLQFKIURPUHDUUROOHUHGJH$OVRSRVLWLRQWKHEHOW HGJHVZLWKLQWKHEHOWEDUULHU ½ inch Tensioning Bolt 92 Modules SS 11 Stride (Walking) System:How To’s M051-00K65-A003 Masking Tape  To properly tension a new striding belt without the use of tension JDXJHVSODFHWZRSLHFHVRIPDVNLQJWDSHH[DFWO\LQFKHV DSDUWRQWKHULJKWDQGOHIWHGJHVDVVKRZQIRXUSLHFHVWRWDO  $OWHUQDWLYHO\\RXFDQPDUNWZROLQHVLQFKHVDSDUWRQWKH PDVNLQJWDSH  To tension the new striding belt, rotate the tension bolts clockwise until the distance between the pieces of tape (or lines on the tape) is increased to 39 inches for a NEW striding belt (38 15/16 inches IRUDQH[LVWLQJEHOW   6WDUWWKHWUHDGPLOODQGUXQLWDWVHYHQPSK ´/RRVH/HQJWK ´7HQVLRQHG/HQJWKIRU New Belt ´7HQVLRQHG Length for Used Belt  If the striding belt moves to the right, using a 5/16 inch Allen wrench, turn the right tension bolt 1/8-turn clockwise and the left tension bolt 1/8-turn counterclockwise to start centering the striding EHOWDERXWWKHUHDUUROOHU Striding Belt Pivot Point  If the striding belt moves to the left, turn the left tension bolt 1/8-turn clockwise and the right tension bolt 1/8-turn counterclockwise to VWDUWFHQWHULQJWKHVWULGLQJEHOWDERXWWKHUHDUUROOHU  Continue adjusting belt until it is centered and does not move to RQHVLGHRUWKHRWKHU  Run treadmill at two mph and while on treadmill come down hard RQWKHVWULGLQJEHOW,IWKHIURQWUROOHUVSLQVZKHQWKHVWULGLQJEHOW PRPHQWDULO\VWRSVWKHEHOWLVORRVH equal equal  If the belt is loose, tighten it by rotating each tensioning bolt 1/4 turn clockwise and repeat steps 14 to 16 until the front roller does not VSLQ Rear Roller 93 Modules SS 12 Stride (Walking) System:How To’s M051-00K65-A003 REMOVAL OF STRIDE SENSOR ASSEMBLY  /RRVHQVWULGLQJEHOWSHH66 8  NOTE: Don’t forget to count the number of turns on the tensioning EROWUHTXLUHGWRORRVHQWKHEHOWDQGUHPRYHWKHGHFN7KLVZLOO VLPSOLI\UHWHQVLRQLQJWKHEHOWWRWKHVDPHWHQVLRQ  5HPRYHGHFNSHHSS 8 CAUTION:%HFDUHIXOQRWWRGURSWKHGHFNRQWKHVWULGHVHQVRU Stride Sensor Cable Routing Through 3 Grommets in Frame Stride Sensor Connector at Controller  Disconnect stride sensor cable connector from controller in motor SDQ  )LVKFDEOHWKURXJKIUDPH NOTE: 7\LQJDFRUGRQWKHHQGRIWKHFRQQHFWRUZLOOKHOSWR¿VKWKH QHZFDEOHWKURXJKWKHIUDPH  5HPRYHH[LVWLQJVWULGHVHQVRU Screw and Flat Washer (25-35 in-lbs) >NJFP@ Stride Sensor Assembly  ,QVWDOOQHZVWULGHVHQVRU  NOTE: 0RXQWVWULGHVHQVRUSDUDOOHOWRIUDPHDVVKRZQ NOTE:%HFDUHIXOQRWWRGDPDJHWKHFDEOHZKHQ¿VKLQJLWWKURXJK WKHIUDPH  5HLQVWDOOWKHGHFNSHHSS 8  5HWHQVLRQWKHVWULGLQJEHOWSHHSS 8 ´ >PP@ 94 Modules LF 1 Lower Frame: System Components Top Motor Shroud Bottom Motor Shroud M051-00K65-A003 Anti-Slip Pad Side Shroud End Cap Lower Plastic Extrusion Extrusion 95 Modules LF 2 Lower Frame: Problem Symptom Table M051-00K65-A003 SYMPTOM POSSIBLE CAUSE SECTION PAGE Anti-slip pad assemblies are loose Pad not properly placed or GDPDJHG 5HSODFHDQWLVOLSSDG LF 7 Motor shroud cover is off or loose Improper placement Replace motor shroud FRYHU LF 3 (Top) Loose upright covers Improper placement 5HSODFHXSULJKWFRYHUV LF 4 Damage LF 5 (Bottom) Damage Loose uprights Damage 5HSODFHXSULJKWV LF 3 Loose end caps Improper placement 5HSODFHHQGFDSV LF 5 5HSODFHORZHUH[WUXVLRQ LF 6 Damage Lower extrusion loose or off Improper placement Customer abuse 96 Modules LF 3 Lower Frame: How To’s M051-00K65-A003 REPLACEMENT OF TOP MOTOR SHROUD COVER  Remove and save the six Phillips screws that secure the top motor  VKURXGFRYHUWRWKHPRWRUFRYHUPRXQWLQJEUDFNHWVDQGIUDPH  Install the new top motor shroud cover using the Phillips screws  VDYHGLQ6WHS 25-35 lb*in >NJ FP@ REPLACEMENT OF UPRIGHTS  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  5HPRYHWKHWRSPRWRUFRYHU  Remove either right or left upright shroud depending on which XSULJKWLVEHLQJUHSODFHG  5HPRYHWKHLQVLGHKDQGUDLOFRYHUV6ee UF 3  5HPRYHWKH$FWLYLW\=RQHDVVHPEO\6ee CA 22   5HPRYHWKHRXWHUKDQGUDLOFRYHUV6ee UF 5   5HPRYHWKHORZHUEULGJHFRYHU6ee UF 4   Remove and save the six upper bolts (three per upright) that secure WKHEULGJHWRWKHXSULJKWV &DEOHVUXQWKURXJKERWKRIWKHXSULJKWV'HWHUPLQLQJZKLFKFDEOH ZLOOEHGLVFRQQHFWHGZLOOGHSHQGRQZKLFKXSULJKWLVEHLQJUHSODFHG If replacing the left upright, this will require disconnecting the power cables to the attachable TV and re-routing them through the new XSULJKW7KHWUDQVIRUPHUFDEOHPXVWEHUHPRYHGDQGUHURXWHGLIWKH OHIWXSULJKWLVEHLQJUHSODFHG Bridge Left Upright Right Upright  Carefully lift the bridge frame assembly up and out of the uprights DQGVHWLWWRWKHVLGH Remove and save the three lower bolts that secure the upright to WKHEDVHIUDPH Install the new upright using the hardware removed in the previous VWHSV 97 Modules LF 4 Lower Frame: How To’s M051-00K65-A003 REPLACEMENT OF UPRIGHT COVERS  5HPRYHWKHWRSPRWRUVKURXGFRYHU  5HPRYHDQGVDYHWKHWZR3KLOOLSVVFUHZVWKDWVHFXUHWKHXSULJKWFRYHUWRWKHXSULJKW  /RRVHQWKHVFUHZVHFXULQJWKHXSULJKWFRYHUWRWKHPDLQIUDPHLQIURQWRIWKHXSULJKW   5HPRYHWKHXSULJKWFRYHU Screw (2) Right Upright Cover  ,QVWDOOWKHQHZXSULJKWFRYHUXVLQJWKHVFUHZVUHPRYHGLQ6WHS All Screws: Torque to LQ OE >NJ FP@ Example of a Bad Gap Example of a Good Gap Upright Mismatch Top Motor Cover Example of a good gap Bottom Side Shroud 98 Modules LF 5 Lower Frame: How To’s M051-00K65-A003 REPLACEMENT OF END CAPS Torque to LQ OE >NJ FP@  Remove and save the two Phillips screws that secure the right or OHIWUHDUHQGFDSWRWKHIUDPH  ,QVWDOOWKHQHZUHDUHQGFDSXVLQJWKHVFUHZVVDYHGLQ6WHS REPLACEMENT OF BOTTOM MOTOR SHROUD COVER  5HPRYHWKHWRSPRWRUVKURXGFRYHU6ee LF 3   Remove and save the four Phillips screws that secure the bottom PRWRUVKURXGFRYHUWRWKHPRWRUFRYHUPRXQWLQJEUDFNHWV  Install the new bottom motor shroud cover using the screws UHPRYHGLQ6WHS Lo L owe w r Motor Mo oto tor Lower Shroud Shro Sh roud ud Lower Motor Shroud Lower Motor Shroud Screws (2 of 4 shown) Torque to LQ OE >NJ FP@ 99 Modules LF 6 Lower Frame: How To’s M051-00K65-A003 REPLACEMENT OF LOWER EXTRUSIONS Upper Extrusion  5HPRYHWKHFRUUHVSRQGLQJULJKWRUOHIWUHDUHQGFDS6ee LF 5  Rear End Cap Foam Strip Lower Extrusion  The lower frame extrusion is attached to the frame by a series of 9HOFURVWULSVPRXQWHGDORQJWKHOHQJWKRIWKHIUDPH6HSDUDWHWKH Velcro strips and pull the lower frame extrusion out and away from WKHVLGHRIWKHWUHDGPLOO  Save the foam strip that is positioned between the upper and lower H[WUXVLRQV  ,QVWDOOWKHQHZORZHUIUDPHH[WUXVLRQ  Install the foam strip by pressing it into the space between the lower DQGXSSHUIUDPHH[WUXVLRQV Upper Extrusion Velcro Strip (one of four) Upper Extrusion 100 Modules LF 7 Lower Frame: How To’s M051-00K65-A003 Anti-slip Pad REPLACEMENT OF UPPER EXTRUSION/ANTI-SLIP ASSEMBLY Upper Extrusion  5HPRYHWKHWRSPRWRUVKURXGFRYHU6ee LF 3   5HPRYHWKHXSULJKWVKURXG6ee LF 4   Remove the Phillips screws that secure the motor cover mounting EUDFNHWWRWKHXSSHUH[WUXVLRQ  1RWHWKHORFDWLRQRIWKHDQWLVOLSSDG Upright Cover  8VLQJDVPDOOÀDWEODGHVFUHZGULYHUFDUHIXOO\SU\XSRQHHQGRIWKH DQWLVOLSSDG  Continue to peel the anti-slip pad until it is completely removed from WKHH[WUXVLRQ  5HPRYHWKHORZHUH[WUXVLRQ6ee LF 6   Remove and save the nine screws that secure the upper extrusion WRWKHIUDPH  ,QVWDOOWKHXSSHUH[WUXVLRQWRWKHIUDPH 3HHOWKHEDFNLQJRIIWKHDQWLVOLSSDG Torque to LQ OE >NJ FP@  Position the pad on the upper extrusion, using the locating tabs on WKHEDFNRIWKHDQWLVOLSSDG Locating Tab 3UHVVGRZQ¿UPO\RQWKHDQWLVOLSSDGWRDGKHUHLWVHFXUHO\WRWKH H[WUXVLRQ 101 Modules UF 1 Upper Frame: System Components M051-00K65-A003 Console Upper Bridge Cover Outer Handrail Cover Ergo bar and Activity Zone Inner Handrail Cover Lower Bridge Cover 102 Modules UF 2 Upper Frame: Problem Symptom Table M051-00K65-A003 SYMPTOM POSSIBLE CAUSE SECTION PAGE Inside handrail shroud ORRVHRUPLVDOLJQHG Improper assembly Replace inside handrail VKURXG UF 3 Replace outside handrail VKURXG UF 5 Replace upper bridge FRYHU UF 6 Replace lower bridge FRYHU UF 4 5HSODFHKDQGUDLO UF 3 Damaged component Outside handrail shroud ORRVHRUPLVDOLJQHG Improper assembly Upper bridge cover loose RUPLVDOLJQHG Improper assembly Lower bridge cover loose or PLVDOLJQHG Improper assembly Handrail need loose or PLVDOLJQHG Improper assembly Damaged component Damaged component Damaged component Damaged component 103 Modules UF 3 Upper Frame: How To’s M051-00K65-A003 REPLACEMENT OF INSIDE HANDRAIL COVERS  5HPRYHDQGVDYHWKH¿YHSOXJVLQWKHLQVLGHKDQGUDLOFRYHUVWKDW FRQFHDOWKHPRXQWLQJEROWV  5HPRYHDQGVDYHWKH¿YH$OOHQEROWVWKDWVHFXUHWKHLQVLGHKDQGUDLO FRYHUWRWKHKDQGUDLO Allen Screw (5) Plug (5) Torque to 42 in-lb >NJ FP@  Remove the cover by tilting it forward the inside of the unit, then SXOOLQJGRZQ  Install the new Inside Handrail Cover, using the bolts removed and VDYHGLQ6WHS 104 Modules UF 4 Upper Frame: How To’s M051-00K65-A003 REPLACEMENT OF LOWER BRIDGE COVER  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  5HPRYHWKHFXSKROGHUV  5HPRYHWKH$FWLYLW\=RQHDVVHPEO\SHHCA 22   5HPRYHDQGVDYHWKHWZR$OOHQEROWVWKDWVHFXUHWKHORZHUEULGJHFRYHUWRWKHEULGJHZHOGPHQW  5HPRYHDQGVDYHWKHWZR$OOHQEROWVWKDWVHFXUHWKHORZHUEULGJHFRYHUWRWKHXSSHUEULGJHFRYHU  7LOWWKHORZHUEULGJHFRYHUWRHLWKHUVLGHRIWKHXQLWWRHQDEOHWKHORZHUEULGJHFRYHUWRFOHDUWKHXSULJKWEROWKHDGV  5HPRYHWKHORZHUEULGJHFRYHU  ,QVWDOOWKHQHZORZHUEULGJHFRYHUXVLQJWKHEROWVUHPRYHGDQGVDYHGLQ6WHSVDQG Bridge Weldment Lower Bridge Cover Allen Screws (10) Torque to 42 in-lb >NJ FP@ Example of a Bad Gap Bottom Bridge Cover Upright Bolt Heads (2 on each side) Example of a Good Gap Outer Arm Shroud Mismatch 105 Modules UF 5 Upper Frame: How To’s M051-00K65-A003 REPLACEMENT OF OUTSIDE HANDRAIL COVERS  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  5HPRYHWKHFXSKROGHUV  5HPRYHWKHKDQGUDLOFRYHUSHHUF 7   5HPRYHWKH$FWLYLW\=RQHDVVHPEO\SHHCA 22   5HPRYHWKHORZHUEULGJHFRYHUSHHUF 4   Remove and save the six Allen bolts that secure the outer handrail FRYHUWRWKHKDQGUDLO Allen Bolts (6) Torque to 42 in-lb >NJ FP@  5HPRYHWKHRXWHUKDQGUDLOFRYHU.  Install the new outer handrail cover using the bolts removed and VDYHGLQ6WHS Handrail Outer Handrail Cover Example of a Bad Gap Right Handrail Overmold Right Handrail Outer Shroud Example of a Good Gap 106 Modules UF 6 Upper Frame: How To’s M051-00K65-A003 REPLACEMENT OF UPPER BRIDGE COVER Torque to 42 in-lb >NJ FP@  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  5HPRYHWKHFXSKROGHUV  5HPRYHWKHFRQVROHDVVHPEO\  5HPRYHWKHFRQVROHQHFNDVVHPEO\  5HPRYHWKHLQVLGHKDQGUDLOFRYHUVSHHUF 3   5HPRYHWKH$FWLYLW\=RQHDVVHPEO\SHHCA 22   5HPRYHWKHORZHUEULGJHFRYHUSHHUF 4   5HPRYHWKHRXWHUKDQGUDLOFRYHUV SHHUF 5  5HPRYHDQGVDYHWKHVL[EROWV  5HPRYHWKHXSSHUEULGJHFRYHU Install new upper bridge cover using the bolts removed and saved LQ6WHS Example of a good gap 107 Modules UF 7 Upper Frame: How To’s M051-00K65-A003 Ergo bar REPLACEMENT OF HANDRAILS Screw (2) Torque to IWOE >1P@  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  5HPRYHWKHFXSKROGHUV  5HPRYHWKHLQVLGHKDQGUDLOFRYHUVSHHUF 3   5HPRYHWKH$FWLYLW\=RQHDVVHPEO\SHHCA 22   5HPRYHWKHORZHUEULGJHFRYHUSHHUF 4   5HPRYHWKHRXWHUKDQGUDLOFRYHUVSHHUF 5   Remove and save the two bolts that secure the handrail to the Ergo EDU  Remove and save the two Allen bolts that secure the handrail to the XSULJKW 5HPRYHWKHKDQGUDLO  Install the new handrail using the bolts removed and saved in Steps   Handrail Allen Bolt (2) Torque to 62 ft-lb >1P@ REPLACEMENT OF ERGO BAR  7XUQWKHWUHDGPLOOSRZHUVZLWFKRII  8QSOXJWKHOLQHFRUGIURPWKHZDOORXWOHW  5HPRYHWKHFXSKROGHUV Washers (3) Screw to Bridge Frame (3)  5HPRYHWKHLQVLGHKDQGUDLOFRYHUVSHHUF 3   5HPRYHWKH$FWLYLW\=RQHDVVHPEO\SHHCA 22   5HPRYHWKHORZHUEULGJHFRYHUSHHUF 4   5HPRYHWKHRXWHUKDQGUDLOFRYHUV (See UF 5)  Remove and save the two bolts that secure the handrail to the Ergo EDU  Remove and save the three bolts that secure the Ergo bar to the EULGJHIUDPH 'LVFRQQHFWWKHKHDUWUDWHFDEOHIURPWKH(UJREDUWRWKHFRQVROH  Install the new Ergo bar assembly using the hardware removed and VDYHGLQ6WHSVDQG Washers (2 on each side) Screw to Handrails (2 on each side) Torque to IWOE >1P@ 108 Appendix Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Overview 7KLVGRFXPHQWLVLQWHQGHGWRSURYLGHDKLJKOHYHORYHUYLHZRI6\VWHP'LDJQRVWLFÀRZVDVZHOODVVFUHHQE\VFUHHQOD\RXW DQGGHVFULSWLRQVRIWKHLULQWHQGHGIXQFWLRQDOLW\IRUWKH(QJDJH,QVSLUHFRQVROHV 110 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: System Options - Block Diagram Overview System Flows System Options Main Menu System Test Statistics Motor Modules (TR only) or System Diagnostics (Non-TR) Information &RQ¿JXUDWLRQ Stride Sensor Test Statistics Date and Time Information Manager VIVO/ Network External Serial EE Test Software Versions System Errors Manufacturer Clock Main Motor Information (TR only) Maintenance Information Video / FM Radio Keypad Test CSAFE Network Test Status Lift Motor Information (TR only) Usage Log Custom Workouts Heart Rate Test CSAFE Loopback Test Belt / Deck Information (TR only) Channel Usage Log Touch Screen &RQ¿JXUDWLRQ iPod® Maintenance Export / Import Settings Test Engineering NOTE:³75RQO\´PHDQVIRU7UHDGPLOORQO\2Q%LNHVDQG&URVV7UDLQHUVWKRVHPRGXOHVPDUNHGZLWK³75RQO\´ZLOOQRW EHYLVLEOH 111 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: System Options - Main Menu User Interface Object Table LABEL DESCRIPTION System Test Button 'LVSOD\VWKH6\VWHP7HVW0HQX6FUHHQ Information Button 'LVSOD\VWKH,QIRUPDWLRQ0HQX6FUHHQ &RQ¿JXUDWLRQ%XWWRQ 'LVSOD\VWKH&RQ¿JXUDWLRQ0HQX6FUHHQ Maintenance Button 'LVSOD\VWKH0DLQWHQDQFH6FUHHQ Exit Button ([LWVRXWRIWKH6\VWHP2SWLRQV±0DLQ0HQXDQGUHWXUQVWRWKH$WWUDFW6FUHHQ Readouts Model:'LVSOD\VWKHFXUUHQWPRGHOQXPEHU Base Assembly Serial #:'LVSOD\VWKHEDVHDVVHPEO\VHULDOQXPEHU Console Version: Displays the current installed console software version number EXLOGQXPEHU  Interface Board Version:'LVSOD\VWKHFXUUHQWLQWHUIDFHERDUGVRIWZDUHYHUVLRQ 112 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: System Test Menu 1 User Interface Object Table LABEL DESCRIPTION System Communication Test Button Displays System Communication Checks Screen and executes system communication FKHFN Motor Modules (TR only) or System Diagnostics Button (Non-TR only) 'LVSOD\VWKH0RWRU0RGXOHV6FUHHQIRU75RU6\VWHP'LDJQRVWLF6FUHHQIRUQRQ75 Key Pad Test Button 'LVSOD\VWKH.H\3DG7HVW6FUHHQ Heart Rate Test Button 'LVSOD\VWKH+HDUW5DWH7HVW6FUHHQ iPod Button Displays the iPod®7HVW6FUHHQ Test Engineering Button 'LVSOD\VWKH7HVW(QJLQHHULQJ6FUHHQ Back Button 'LVSOD\VWKHSUHYLRXVVFUHHQ Forward Button 'LVSOD\VWKH6\VWHP7HVW0HQX6FUHHQ ® 113 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: System Communication Check User Interface Object Table LABEL DESCRIPTION Motor Controller 'LVSOD\VWKHVWDWXVRIWKH0RWRU&RQWUROOHULH&KHFNLQJ'HWHFWHG)DLOHG Lift System 'LVSOD\VWKH0RWRU0RGXOHV6FUHHQ External Serial EE System 'LVSOD\VWKH.H\3DG7HVW6FUHHQ Information 'LVSOD\VDQ\DGGLWLRQDOLQIRUPDWLRQUHJDUGLQJWKH6\VWHP&RPPXQLFDWLRQFKHFNLH System Communication OK, System Communication Failed, Error - Communication 7HVW5HVXOWV1RW$YDLODEOH  iPod® Button Displays the iPod®7HVW6FUHHQ Back Button 'LVSOD\VWKHSUHYLRXV6FUHHQ Main Menu Button Goes back to the System Options – Main Menu NOTE: This test checks the communications between the MIBDQG0RWRU&RQWUROOHUERDUGVLH6\VWHP &RPPXQLFDWLRQ 7KH/LIW6\VWHPDQG([WHUQDO6HULDO((6\VWHPDUHSDUWRIWKH0RWRU&RQWUROOHUERDUG7RUHSHDWWHVW SUHVV%DFNEXWWRQDQGWKHQ6\VWHP&RPPXQLFDWLRQ7HVWEXWWRQ 114 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Motor Modules (TR Only) User Interface Object Table LABEL DESCRIPTION Module Errors Lift: Displays module error for incline Motor: Displays module error for motor controller Note:,IWKHUHDUHQRHUURUVWKHPHVVDJHFHQWHUUHSRUWV³1R0RWRU0RGXOH(UURUV´HWF2QO\ HUURUVRFFXUULQJLQUHDOWLPHDUHVKRZQKHUH7RVHHDQ\SDVWHUURUVJRWRWKH³6\VWHP(UURUV´ VHFWLRQ Mode Auto: Automatically switch the incline (Incline will move and automatically stop at the commanded value as selected using the incline Up/Down keys) Manual: Manually adjust the incline up/down (incline moves when either the Incline Up or 'RZQDUURZNH\VDUHKHOGDQGVWRSVPRYLQJZKHQWKHVHNH\VDUHUHOHDVHG1RWHWKDWWKH incline movements will not stop even if the incline Home Switch (or incline negative switch, if HTXLSSHG LVHQFRXQWHUHG Console Temperature 'LVSOD\VWKHFXUUHQWFRQVROHWHPSHUDWXUH Actual Actual incline:'LVSOD\VWKHFXUUHQWDQGDFWXDOLQFOLQHSHUFHQWDJH Actual RPM and MPH: Displays the current and actual RPM if the RPM radio button is VHOHFWHGRU03+LIWKH03+UDGLREXWWRQLVVHOHFWHG Current Trip If lift, then a dynamic or temporary current trip has been detected by the motor controller typically due to an excessive load Info Watts:'LVSOD\VWKHFXUUHQWZDWWDJH Power: 'LVSOD\VWKHFXUUHQWSRZHUFRQVXPSWLRQ Temperature: Displays the current temperature of the motor controller board and surrounding DUHD¶V Bus Voltage:'LVSOD\VWKHFXUUHQW%XVYROWDJH Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button Goes back to the System Options – Main Menu NOTE:7KHLQIRUPDWLRQEHORZWKHPHVVDJHFHQWHULVIRUHQJLQHHULQJXVHDQGLVUHODWHGWRVSHFL¿FFRPPXQLFDWLRQ PRGXOHVLH³,&´ LQFOLQHFRQWUROOHU0& PRWRUFRQWUROOHUHWF 115 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: System Diagnostics Check (Non – TR only) User Interface Object Table LABEL DESCRIPTION Readouts Battery Voltage: Displays the current battery voltage Console Current (mA): 'LVSOD\VWKHFXUUHQWRIWKHFRQVROHLQPLOOLDPSV Brake Current (mA):'LVSOD\VWKHEUHDNFXUUHQWLQPLOOLDPSV GBC Bus Voltage:'LVSOD\VWKHFXUUHQWYROWDJHRIWKH*%& RPM:'LVSOD\VWKHFXUUHQW530 External Powered: Yes or No Console Temperature:'LVSOD\VWKHFXUUHQWFRQVROHWHPSHUDWXUHLQ&HOFLXV GBC Temperature: 'LVSOD\VWKHFXUUHQW*%&WHPSHUDWXUHLQ&HOFLXV Watts Control ,QSXWVWKHDPRXQWRI:DWWDJHWREHWHVWHG Back *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX 116 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Key Pad Test User Interface Object Table LABEL DESCRIPTION Readouts Activity Zone Status: Displays the Activity Zone keypad status (Detected or 8QSOXJJHG :KHQNH\VDUHSUHVVRQWKLVNH\SDGWKH\ZLOOVKRZQXSLQWKH.H\3DG 9DOXHDUHD Key Pad Value:'LVSOD\VWKHQDPHRIWKHNH\SDGEXWWRQWKDWLVEHLQJSUHVVHG Emergency Stop Switch: 'LVSOD\VWKHVWDWXVRIWKH(66LH$WWDFKHGRU1RW $WWDFKHG  Back *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX NOTE: The additional information at the bottom of the screen is for engineering use and represents communication data between the MIB and SBCFRQFHUQLQJKDUGNH\SUHVVHYHQWV 117 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Heart Rate Test User Interface Object Table LABEL DESCRIPTION &RQ¿GHQFH 0-9:'LVSOD\VWKHFRQ¿GHQFHOHYHOIURP±IRUWKHKHDUWUDWHUHDGLQJRQWKHLifePulse® sensors Readouts Telemetry HR: Shows the telemetry strap heart rate reading If Telemetry(OFF) is shown WKHQWHOHPHWU\KDVEHHQGLVDEOHGLQ0DQDJHU¶V&RQ¿JXUDWLRQ Hands on:6KRZVGHWHFWLRQRIKDQGVRQRIIRQWKHOHIWDQGULJKW/LIH3XOVHVHQVRUV / 5  QRKDQGVRQGHWHFWHG/ 5  KDQGVRQGHWHFWHG LifePulse® HR: Shows the LifePulse®KHDUWUDWHUHDGLQJ,ILifePulse®(OFF) is shown WKHQ/LIH3XOVHKDVEHHQGLVDEOHGLQ0DQXIDFWXUHU¶V&RQ¿JXUDWLRQ &RQ¿GHQFH6KRZVWKHFRQ¿GHQFHOHYHORIWKHKHDUWUDWHGHWHFWLRQVLJQDO Gain:6KRZVWKHDPSOL¿FDWLRQOHYHORIWKH/LIH3XOVHKHDUWUDWHVLJQDO$VWURQJVLJQDO UHVXOWVLQOHVVUHTXLUHGJDLQ:HDNHUVLJQDOVUHVXOWVLQDKLJKHUJDLQ Packets:6KRZVWKHGDWDSDFNHWWKDWLVEHLQJWUDQVPLWWHG Incline: 6KRZVWKHFXUUHQWLQFOLQH75RQO\  Speed:6KRZWKHFXUUHQWVSHHG Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX NOTE: You can use the Activity Zone Incline/Speed Up/Down arrow keys to control the belt and incline motors in this WHVWPRGH 118 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: iPod Test ® User Interface Object Table LABEL DESCRIPTION Readouts iPod®: Displays the status of the iPod®LH8QSOXJJHGRUGHWHFWHG  CP:'LVSOD\VWKHVWDWXVRIWKHFRSURFHVVRUDXWKHQWLFDWLRQFKLSLHGHWHFWHGRUQRW GHWHFWHG  Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX 119 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Test Engineering User Interface Object Table LABEL DESCRIPTION Phase Test Readouts NULL Report:&KHFNVWKHEDODQFHRIWKHSKDVHV7KLVYDOXHVKRXOGEH D  Phase U/W/V Low/High:&KHFNVWKHLQGLYLGXDOSKDVHVDQGWUDQVLVWRUV7KHVHYDOXHV VKRXOGEHLQWKH¶VaDD ,IRQHSKDVHSDLU/RZ+LJK VKRZVYHU\ORZWKH FDEOHFRQQHFWRURUPRWRUQHHGVWREHFKHFNHG,ILQGLYLGXDOSKDVHV DUHVXEVWDQWLDOO\ GLIIHUHQWWKH'63ERDUGQHHGVWREHFKHFNHG Start Test Button 5XQVWKHWHVWHQJLQHHULQJSKDVHWHVW Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX 120 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: System Test Menu 2 User Interface Object Table LABEL DESCRIPTION Stride Sensor Test Button (TR only) Displays Stride Sensor Test Screen and executes the stride sensor test 75RQO\  External Serial EE Test Button 'LVSOD\VWKH([WHUQDO6HULDO((7HVW6FUHHQ CASFE Network Test / Status Button Displays CSAFE Network Test / Status Screen and executes the CSAFE 1HWZRUN7HVW CSAFE Loopback Test Button Displays the CSAFE Loopback7HVW6FUHHQ Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX 121 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Stride Sensor Test (TR only) User Interface Object Table LABEL SPECIFICATION User Status Shows the detection status of a user on the belt (User Detected On Belt or User Not Detected 2Q%HOW $GGLWLRQDOVWDWXVLQIR³6WULGH6HQVRU'LVDEOHG´VHH6WULGH6HQVRU6\VWHPEHORZ RU ³6WULGH6HQVRU8QSOXJJHG´,IVHQVRULVGHWHFWHGDVXQSOXJJHGWKHVRIWZDUHZLOOSHULRGLFDOO\ WU\DQGUHGHWHFWVHQVRUZKLOHLQWKLVWHVWPRGH:KLOHUHGHWHFWLQJD³*HWWLQJ6WDWXV«´ PHVVDJHZLOOEHVKRZQ Adjust Belt Stop 7ULJJHUSRLQWDGMXVWPHQW=HUR XVHLQWHUQDOGHIDXOWWULJJHUSRLQWYDOXH  :KHQWKH $YHUDJHYDOXHGHFD\VWRWKHWULJJHUSRLQWWKHVWDWXVZLOOFKDQJHWR³8VHU1RW'HWHFWHG2Q %HOW´+LJKHU$GMXVWYDOXHVUHVXOWVLQDTXLFNHUDFWLQJV\VWHP$ORZHUYDOXHUHVXOWVLQWDNLQJ PRUHWLPHWRGHWHFWDXVHUKDVOHIWWKHEHOW$GMXVWLQJYDOXHVWKDWDUHWRRORZFDQUHVXOWLQ V\VWHPQHYHUGHWHFWLQJWKDWDXVHUKDVOHIWWKHEHOW&KDQJHWKLVDGMXVWPHQWRQO\ZKHQ UHFRPPHQGHGWRGRVR Stride Sensor System $OORZVWKH6WULGH6HQVRU6\VWHPWREHHQDEOHGRUGLVDEOHG:KHQGLVDEOHG8VHU6WDWXV  ³6WULGH6HQVRU'LVDEOHG´ Average 5XQQLQJDYHUDJHRIUDZUHDGLQJ¿OWHUHGYDOXH :KHQWKLVVORZHUFKDQJLQJYDOXHGHFD\V WRWKHWULJJHUSRLQWVHH$GMXVW%HOW6WRS WKH8VHU6WDWXVFKDQJHVWR³8VHU1RW'HWHFWHG2Q %HOW´ Raw 7KLVLVWKHUDZUHDGLQJIURPWKHVWULGHVHQVRU5HDGLQJUHSUHVHQWVUHDOWLPHDFWXDWLRQVRIWKH VWULGHVHQVRU7KLVLVDIDVWFKDQJLQJYDOXHDVRSSRVHGWRWKH$YHUDJHYDOXHDERYH :KHQ VHQVRUGHÀHFWVUDZUHDGLQJMXPSVWRPD[RUFORVHWRPD[0D[  Readouts The information in this section is for engineering purposes and represents data being received IURPWKHPRWRUFRQWUROOHUDVZHOODVLQWHUQDOKROGRIIDQGJUDFHSHULRGWLPHUV Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button Goes back to the System Options – Main Menu NOTE: You can use the Activity Zone Incline/Speed Up/Down arrow keys to control the belt and incline motors in this WHVWPRGH 122 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: External Serial EE Test User Interface Object Table LABEL SPECIFICATION External Serial EE Test Button ([HFXWHVDQGGLVSOD\VWKHWHVWLQSURJUHVVSRSXSZLQGRZ 7HVWUHVXOWZLOOEHGLVSOD\HGLQDSRSXSZLWKDVWDWXVRI3DVVRU)DLOHG This test will verify the proper operation of the serial EE storage chip located on the PRWRUFRQWUROOHUZKLFKLVXVHGWRVWRUHWKH0DLQ0RWRU,QIRDQGEDVLFFRQ¿JXUDWLRQ LQIRUPDWLRQSURGXFWW\SHHWF  Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX 123 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: CSAFE Network Test or Status User Interface Object Table LABEL SPECIFICATION Information Readouts Rx Packets:'LVSOD\VWKHQXPEHURIGDWDSDFNHWVUHFHLYHG Tx Packets:'LVSOD\VWKHQXPEHURIGDWDSDFNHWVWUDQVPLWWHG Timeout Timer:'LVSOD\VWKHWLPHRXWLQVHFRQGV CSAFE State:'LVSOD\VWKHFXUUHQWVWDWHRIWKH&6$)(QHWZRUN Previous Bads: Displays the number of bad requests Net Down Timer:'LVSOD\VWKHGRZQWLPHRIWKHQHWZRUNLQVHFRQGV &RQ¿JXUDWLRQ5HDGRXWV ID Length:'LVSOD\VWKH,'OHQJWKQXPEHU Timeout Period:'LVSOD\VWKHWLPHRXWLQVHFRQGV Up-List:'LVSOD\VWKHQXPEHURIXSOLVWLWHPV CSAFE Version Readouts Manufacturer:'LVSOD\VWKHPDQXIDFWXUHU¶V,'QXPEHU CID:'LVSOD\VWKHFRQQHFWLRQ,'QXPEHU Model:'LVSOD\VWKHPRGHOQXPEHU Version:'LVSOD\VWKHYHUVLRQQXPEHU Release: Displays the release number Reset Connection Button 5HVHWVWKHFRQQHFWLRQWRWKH&6$)(QHWZRUN Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX NOTE:7KLVWHVWVKRZVPDQ\&6$)(FRPPXQLFDWLRQVSHFL¿FDWLRQSDUDPHWHUVDQGLVLQWHQGHGWRSURYLGHPRUH GHWDLOHGLQIRUPDWLRQIRUHQJLQHHULQJDQGWKLUGSDUW\FRPSDQLHVWKDWPDNHFRPSDWLEOH&6$)(GHYLFHV8VHWKH ³&6$)(Loopback7HVW´WRWHVWWKHFRQVROH¶V&6$)(SRUW 124 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: CSAFE Loopback Test User Interface Object Table LABEL SPECIFICATION Instructions Displays the seven steps instructions to perform the CSAFE Loopback7HVW Test Log 'LVSOD\VDQGORJVWKHVWDWXVRIDOOWKHWHVWLQJVWHSVDQGUHVXOWV CSAFE Loopback Status Displays the status of the loopbackWHVWLH3DVVRU)DLO  Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX NOTE: This test is used to verify the console’s CSAFE port and to provide instructions on how to use and diagnose SRUWSUREOHPV 125 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Information Menu User Interface Object Table LABEL DESCRIPTION Statistics Button 'LVSOD\VWKH,QIRUPDWLRQ6WDWLVWLFV6FUHHQ Software Versions Button 'LVSOD\VWKH6RIWZDUH9HUVLRQV6FUHHQ Main Motor Information Button 'LVSOD\VWKH0DLQ0RWRU,QIRUPDWLRQ6FUHHQ Lift Motor Information Button 'LVSOD\VWKH/LIW0RWRU,QIRUPDWLRQ6FUHHQ Belt / Deck Information Button 'LVSOD\VWKH%HOW'HFN,QIRUPDWLRQ6FUHHQ Date and Time Information Button 'LVSOD\VWKH6\VWHP'DWHDQG7LPH,QIRUPDWLRQ6FUHHQ System Errors Button 'LVSOD\VWKH6\VWHP(UURUV6FUHHQ Maintenance Information Button 'LVSOD\VWKH0DLQWHQDQFH,QIRUPDWLRQ6FUHHQ Usage Log Button 'LVSOD\VWKH8VDJH/RJ5HSRUW6FUHHQ Channel Usage Log Button 'LVSOD\VWKH79&KDQQHO8VDJH/RJ6FUHHQ Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX 126 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Information Statistics User Interface Object Table LABEL DESCRIPTION Information Readouts POWER-UP COUNT:6KRZVPDQ\WLPHVWKHV\VWHPKDVEHHQSRZHUHGXS TOTAL HOURS:6KRZVWKHWRWDOKRXUVRIPDFKLQHXVDJH TOTAL MILES:6KRZVWKHWRWDOPLOHVDFFXPXODWHGIRUWKHPDFKLQH BELT HOURS:6KRZVWKHWRWDOQXPEHURIKRXUVDFFXPXODWHGIRUWKHEHOWXVDJH BELT MILES:6KRZVWKHWRWDOQXPEHURIPLOHVDFFXPXODWHGIRUWKHEHOWXVDJH LIFT HOURS:6KRZVWKHWRWDOQXPEHURIKRXUVRIXSLQFOLQHRSHUDWLRQV CHANGE WORKOUTS: Show the total number of times this feature was LQYRNHG QUICK:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDP4XLFN6WDUW ZDVLQYRNHG MANUAL:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG HILL:6KRZVWKHWRWDOQXPEHURIWLPHWKLVSURJUDPZDVLQYRNHG RANDOM:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG FAT BURN:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG PRESET COUNT:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG Nike + iPod® Accepted: Shows the total number of times this feature was DFFHSWHG CARDIO:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG HR HILL:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG HR INTERVAL: 6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG EXTREME HR: 6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG SPEED INTERVAL:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG 127 Appendix M051-00K65-A003 Information Statistics Object Table LABEL DESCRIPTION Information Readouts SPORT TRAINING 5K: Shows the total number of times this program was LQYRNHG SPORT TRAINING 10K: Shows the total number of times this program was LQYRNHG SPORT TRAINING:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG LF FIT TEST: 6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG GERKIN: 6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG Nike + iPod® Rejected: Shows the total number of times this feature was UHMHFWHG WORKOUT COUNT: 6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG ARMY:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG NAVY PRT: 6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG MARINE:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG AIR FORCE:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG NETWORKED: Shows the total number of times a network workout program was LQYRNHG CUSTOM:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVSURJUDPZDVLQYRNHG TIME GOALS:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVIHDWXUHZDVLQYRNHG DISTANCE GOALS:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVIHDWXUHZDVLQYRNHG CALORIES GOALS:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVIHDWXUHZDVLQYRNHG TIME-IN-ZONE GOALS: Shows the total number of times this feature was LQYRNHG MARATHON MODE:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVIHDWXUHZDVLQYRNHG VIDEO:6KRZVWKHWRWDOQXPEHURIWLPHVWKLVIHDWXUHZDVLQYRNHG Export to USB Button ([SRUWDOOWKHLQIRUPDWLRQRQWKHVFUHHQWRD86%VWLFNLQD&69FRPPD VHSDUDWHGYDOXH ¿OH Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX 128 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Software Versions User Interface Object Table LABEL DESCRIPTION Readouts Base Assembly Serial #:'LVSOD\VWKHEDVHDVVHPEO\VHULDOQXPEHU Console Serial #: 'LVSOD\VWKHFRQVROHVHULDOQXPEHU Console Version / Part #: Displays the software version number and part QXPEHU Motor Version / Serial #: Displays the software version number and part QXPEHU LifePulse® Version:'LVSOD\VWKHVRIWZDUHYHUVLRQQXPEHU CSAFE Version:'LVSOD\VWKHVRIWZDUHYHUVLRQQXPEHU Interface Boot Version:'LVSOD\VWKHVRIWZDUHYHUVLRQQXPEHU Interface Board Version / Part #: Displays the software version number and part QXPEHU Console Boot Version:'LVSOD\VWKHVRIWZDUHYHUVLRQQXPEHU Apploader Version:'LVSOD\VWKHVRIWZDUHYHUVLRQQXPEHU Media Manager Version:'LVSOD\VWKHVRIWZDUHYHUVLRQQXPEHU Treadmill/Bike/CT: Date and time of the console software build WinCE Version: Displays the version number of the Windows CE operating V\VWHP Export to USB Button ([SRUWDOOWKHLQIRUPDWLRQRQWKHVFUHHQWRD86%VWLFNLQD&69FRPPD VHSDUDWHGYDOXH ¿OH Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX 129 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Main Motor Information (TR Only) User Interface Object Table LABEL DESCRIPTION Readouts 'HVFULSWLRQDQG9DOXH'LVSOD\VKXWGRZQHUURUVKHDOWKSRZHUDQGYROWDJHLQIRUPDWLRQ Export To USB Button ([SRUWDOOWKHLQIRUPDWLRQRQWKHVFUHHQWRD86%VWLFNLQD&69FRPPDVHSDUDWHG YDOXH ¿OH Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX Shutdown Errors 6KXWGRZQ(UURUVUHFRUGVHYHQWVWKDWFDXVHGWKHPRWRUWRVWRSDQGUHSRUWDQHUURUWRWKHFRQVROH Machine Health Info records events that have not stopped the motor that the system recovered from, but may be an LQGLFDWLRQRIDSRWHQWLDOSUREOHPLQWKHIXWXUH 0D[LPXPVVKRZPRQLWRUHGVLJQDOH[WUHPHVDQGPD\EHXVHIXOLQGLDJQRVLQJSUREOHPV When analyzing the Main Motor Information keep in mind that a Shutdown Error actually caused the belt to stop in a safe PDQQHUEXWQRQHWKHOHVVDQGPRVWOLNHO\ ZKHQDXVHUZDVRQLW/RZYDOXH0DFKLQH+HDOWK,QIRFRXQWVLQJHQHUDODUHQRW DFRQFHUQEXWFRPELQDWLRQVRIWKHPFDQKHOSGHWHUPLQHDPDFKLQHV¶FRQGLWLRQLHDQ\W\SHRI,+LWFRPELQHGZLWKKLJK PD[LPXPSKDVHFXUUHQWV!D FDQEHDQLQGLFDWLRQRIDZRUQEHOW 130 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Main Motor Information (TR Only) Shutdown Errors 6KXWGRZQ(UURUVUHFRUGVHYHQWVWKDWFDXVHGWKHPRWRUWRVWRSDQGUHSRUWDQHUURUWRWKHFRQVROH Machine Health Info records events that have not stopped the motor that the system recovered from but may be an LQGLFDWLRQRIDSRWHQWLDOSUREOHPLQWKHIXWXUH 0D[LPXPVVKRZPRQLWRUHGVLJQDOH[WUHPHVDQGPD\EHXVHIXOLQGLDJQRVLQJSUREOHPV When analyzing the Main Motor Information keep in mind that a Shutdown Error actually caused the belt to stop in a VDIHPDQQHUEXWQRQHWKHOHVVPRVWOLNHO\ZKHQDXVHUZDVRQLW/RZYDOXH0DFKLQH+HDOWK,QIRFRXQWVLQJHQHUDODUHQRW DFRQFHUQEXWFRPELQDWLRQVRIWKHPFDQKHOSGHWHUPLQHDPDFKLQHV¶FRQGLWLRQLHDQ\W\SHRI,+LWFRPELQHGZLWKKLJK PD[LPXPSKDVHFXUUHQWV!D FDQEHDQLQGLFDWLRQRIDZRUQEHOW LABEL DESCRIPTION PLL Clock Lost ,IWKHSKDVHORFNHGORRSFLUFXLWU\GHWHFWVQRFORFNWKLVHUURUZLOORFFXU,IWKH PRWRULVUXQQLQJDQGWKLVRFFXUVWKHPRWRUVWRSVTXLFNO\WXUQLQJRIIWKHGULYH7KH VWDWHRIWKHSKDVHORFNLVPRQLWRUHGHYHU\XV CAUSE 1RLV\V\VWHPRUGHIHFWLYH'63ERDUG ACTION &KHFNDOOJURXQGVDQGFDEOHV¿UVW,IWKHQXPEHULV!WKH'63ERDUGVKRXOGEH FKHFNHG Drive Low-V Trips 1RW8VHG Low Voltage Resets 7KHSURFHVVRUKDVGHWHFWHGDYROWDJHYWRWKHSURFHVVRUEXWLWKDVQ¶WVKXW GRZQ,IWKHPRWRULVUXQQLQJDQGWKLVRFFXUVWKHPRWRUVWRSVLPPHGLDWHO\WXUQLQJ RIIWKHGULYH CAUSE 3RZHUOLQHVXUJHVRUDQLQWHUPLWWHQWOLQHFRUGRUZDOORXWOHW ACTION &KHFNWKHSRZHUVRXUFHDQGOLQHFRUG6DPHDFWLRQDV³/RZ97ULSV´EHORZ Communication Trips If the motor controller stops receiving transmissions from the console for more WKDQVHFRQGVWKHPRWRUZLOOFRPHWRDVWRSDWLWVQRUPDOUDWH7KHLQFOLQHZLOO EHKHOGDWLWVSUHVHQWSRVLWLRQ CAUSE Vibration can cause the connection to become intermittent and disrupt FRPPXQLFDWLRQEHWZHHQWKHFRQVROHDQG0& ACTION &KHFNWKHFRQVROHFDEOHDQGFRQQHFWRUV0DNHVXUHWKH\DUHIXOO\VHDWHG 2EVHUYHFRPPXQLFDWLRQ/(',WVKRXOGEHÀDVKLQJDWDYHU\KLJKUDWHa VHF ,I\RXZLJJOHWKHFDEOHDURXQGDQGWKHÀDVKLQJLVFKDQJHGRUHYHQVWRSSHG WKHUHLVDVWURQJLQGLFDWLRQWKDWWKHFDEOHLVWKHSUREOHP 131 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Main Motor Information (TR Only) LABEL DESCRIPTION Temperature Trips If the current limit reduction scheme fails to control the module temperature, 100c DQRYHUWHPSHUDWXUHWULSZLOORFFXUDW&7KHPRWRUZLOOFRPHWRDVWRSDWLWV QRUPDOUDWH CAUSE ‡$LUÀRZUHVWULFWLRQLQWRWKHPRWRUFRPSDUWPHQWFDXVHGE\EORFNDJHRUOLQW EXLOGXS7KHXQLWLVORFDWHGRYHUDKHDWLQJYHQWDQGKRWDLULVEHLQJEORZQLQWRLW ‡'LUHFWVXQOLJKWRQWKHXQLWFDQFDXVHWKLVHIIHFWDOWKRXJKWRDOHVVHUGHJUHH ‡$VHYHUHO\ZRUQEHOW ACTION Clean in and around the compartment and insure the above conditions are not RFFXUULQJ Over-V Powerdowns If the bus voltage is over 460v and the motor is running, this mode will disengage the motor by gradually removing the drive voltage over a period of approximately DVHFRQGGHSHQGLQJRQLWVSUHVHQWH[FLWDWLRQOHYHO7KLVLVWKH¿QDOPHDVXUHWR SUHYHQWRYHUYROWDJHRQWKHEXVFDSDFLWRUV CAUSE Users actively pushing the belt at running speeds and maximum incline can RYHUFRPHWKHIULFWLRQRIWKHEHOWGHFNVXI¿FLHQWO\WRGHOLYHUSRZHULQWRWKHV\VWHP ACTION Observe if this is actually happening and if so recommend that the user uses a ORZHULQFOLQHZLWKSRVVLEO\DKLJKHUVSHHG Over-V Trips ,IWKHEXVYROWDJHLVRYHUYWKLVHUURUZLOOEHGHWHFWHG,IWKHPRWRULVUXQQLQJ WKHV\VWHPZLOOJRLQWR2YHUYROWDJH3RZHUGRZQ0RGHDERYH 2WKHUZLVHWKH SRZHUUHOD\ZLOOEHRSHQHGLPPHGLDWHO\ CAUSE $VGHVFULEHGDERYHLIWKHXVHUSXVKHVWKHEHOW DVZHOODVDQ\SRZHUOLQHLVVXH ACTION If users are not pushing the belt the power line needs to be monitored for GUDPDWLFDOO\SRRUYROWDJHUHJXODWLRQ Low-V Trips If the bus voltage is lower than the 190v limit when the relay is closed and ESS VZLWFKLVRQDQHUURUFRQGLWLRQZLOOEHWULSSHG7KHSRZHUUHOD\ZLOOEHRSHQHG DQGWKHPRWRUZLOOEHGLVDEOHGIRUFLQJLWWRDFRQWUROOHGVWRS CAUSE 7KHEXVYROWDJHKDVGURSSHGEHORZLWVPLQLPXPRSHUDWLQJYDOXH ACTION An improperly seated power cord or badly installed outlet (loose screws holding WKHZLUHV ZLOOFDXVHWKHYROWDJHWRPRPHQWDULO\VDJWULJJHULQJWKLVHUURU,QVXUH WKDWWKHSURGXFWLVGLUHFWO\FRQQHFWHGWRDGHGLFDWHGFLUFXLW8VLQJDQH[WHQVLRQ FRUGFDQFDXVHWKLVHUURU 132 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Main Motor Information (TR Only) LABEL DESCRIPTION Hardware I-Trips The hardware overcurrent limit has been hit consistently for over 250ms, which FDXVHGDPRWRUVKXWGRZQ CAUSE 3HUVLVWHQWH[FHVVLYHPRWRUFXUUHQWRYHUDZLOOFDXVHWKLVWULS ACTION &KHFNWKDWWKHPRWRUZLULQJLVQRWEHLQJVKRUWHG&KHFNWKDWWKHPRWRUSOXJDQG DOOLWVZLUHVDUHVHDWHGSURSHUO\DQGWKDWWKHUHLVQRFRQWDPLQDWLRQRQWKHSLQV 5XQWKHSKDVHWHVWWRLVRODWHDWURXEOHGSKDVHV  Running Errors If after four seconds the motor hasn’t drawn over 1a motor current this error will EHWULSSHG7KHPRWRUZLOOEHGLVDEOHGIRUFLQJLWWRDFRQWUROOHGUHPRYDORIWKH PRWRUYROWDJH CAUSE $QXQSOXJJHGPRWRUFDEOHRUGDPDJHGPRWRU ACTION 0DNHVXUHWKHPRWRULVSURSHUO\SOXJJHGLQWKHQUXQWKHSKDVHWHVW Dynamic I-Trips ([FHVVLYHPRWRURUOLQHFXUUHQWKDVEHHQGHWHFWHG$QDSSURSULDWHPRWRUUSP GURSZLOOEHFRPPDQGHGWRWU\WRNHHSWKHFXUUHQWZLWKLQLWVOLPLW,QWKLVFDVHWKH PRWRUVORZHGGRZQWRDSRLQWZKHUHLWDFWXDOO\ZHQWLQWRDSDXVHVWDWH CAUSE ([FHVVLYHEHOWDQGGHFNZHDURUYHU\KLJKXVHUZHLJKWDWKLJKVSHHGV ACTION &KHFNWKHEHOWGHFNDQGUHSODFHLIZRUQ 133 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Main Motor Information (TR Only) Machine Health Info LABEL DESCRIPTION Drive Low-V Hits This mechanism, which detects low power supply voltage to the power driver FKLSKDGDKLW CAUSE 3RZHUF\FOLQJDQGRFFDVLRQDOO\QRLVHLQGXFHG ACTION 7KLVHYHQWLVUHFRUGHGRQO\QRDFWLRQLVWDNHQE\WKH'63,Imany are present ! WKHJURXQGVDQGFDEOHVVKRXOGEHFKHFNHG PLL Lost Lock If the phase locked loop circuitry detects a mismatch in desired speed this hit will RFFXU,WZLOORQO\EHUHFRUGHG7KHVWDWHRIWKHSKDVHORFNLVDOVRPRQLWRUHGHYHU\ XV CAUSE %HFDXVHRIQRLVHDQGRWKHUGLVWXUEDQFHVWKHFORFNPD\YDU\VOLJKWO\LQVSHHG1R QRWLFHDEOHDIIHFWVZLOOEHIHOWE\WKHXVHU ACTION 1RDFWLRQLVUHTXLUHGLIWKHQXPEHULVUHODWLYHO\ORZ ,IPDQ\WKHQJURXQGV VKRXOGEHFKHFNHGIROORZHGE\DFKHFNRIWKH'63 EE Communication Errors 7KHSURFHVVRULVXQDEOHWRFRPPXQLFDWHZLWKWKH((3520 CAUSE $GDPDJHG'63ERDUGRU((3520FKLS ACTION ,IRFFXUUHQFHVDUHKLJK! UHSODFHWKH'63ERDUGRUUXQDVLWLV&RQVROHZLOO QRWEHDEOHWRVDYHGDWDLIWKH'63LVIDXOW\ EE Access Errors $ZULWHWRWKH((3520ZDVQRWDFNQRZOHGJHGLQPVRUDZULWHYHULI\IDLOHG CAUSE ‡3RZHUUHPRYHGZKLOHZULWLQJWR((3520 ‡$GDPDJHG'63ERDUGRU((3520FKLS ACTION ,IRFFXUUHQFHVDUHKLJK! UHSODFHWKH'63ERDUGRUUXQDVLWLV&RQVROHZLOO QRWEHDEOHWRVDYHGDWDLIWKH'63LVIDXOW\ IC - No AC Errors 7KHIUHTXHQF\GHWHFWLRQFLUFXLWU\GLGQRWGHWHFWK]RUK]7KHLQFOLQHZLOOVWLOO RSHUDWHKRZHYHUXVLQJWKHGHIDXOWSDUDPHWHUVIRUK] CAUSE 3RZHUF\FOLQJRUDGDPDJHG'63ERDUG ACTION ,IRFFXUUHQFHVDUHKLJK! FKHFNWKH'63ERDUG 134 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Main Motor Information (TR Only) LABEL DESCRIPTION Communication Hits 7KHUHFHLYHPRGXOHRIWKH'63GHWHFWHGDQHUURULQDGDWDSDFNHW7KLVSDFNHW ZLOOEHGLVFDUGHGEXWWKHV\VWHPZLOOFRQWLQXHWRIXQFWLRQ CAUSE $GDPDJHGRULQWHUPLWWHQWFRQVROHFDEOHFDQFDXVHWKHVH$IHZRIWKHVHDUH normal because of occasional power sequencing differences or drive and incline PRWRUQRLVH ACTION &KHFNWKHFRQVROHFDEOHDQGZLULQJ0DNHVXUHDOOJURXQGVDUHVROLG Communication Noise Hits 7KHUHFHLYHPRGXOHRIWKH'63GHWHFWHGQRLVHRQWKHFRPPXQLFDWLRQOLQH,IWKH QRLVHGLGQRWFDXVHDFKHFNVXPHUURUHYHU\WKLQJFRQWLQXHGQRUPDOO\,ILWGLGWKHQ WKHSDFNHWZDVGLVFDUGHGEXWWKHV\VWHPFRQWLQXHGWRIXQFWLRQ CAUSE $OHVVVHYHUHFDVHWKDQDERYHEXWZLWKWKHVDPHFDXVHV ACTION &KHFNWKHFRQVROHFDEOHDQGZLULQJ0DNHVXUHDOOJURXQGVDUHVROLG Dynamic Start I-Hits ([FHVVLYHPRWRUFXUUHQWKDVEHHQGHWHFWHGZKLOHWKHPRWRULVVWDUWLQJ$Q appropriate motor rpm drop will be commanded to try to keep the current within LWVOLPLW7KH'63ZLOOFRQWLQXHPRQLWRULQJWKHFRQGLWLRQIRUIRXUVHFRQGV,IWKH H[FHVVLYHFXUUHQWLVQRWUHGXFHGWRDQDFFHSWDEOHOHYHOWKHPRWRUZLOOVWRS CAUSE $VWDOOHGEHOWFRQGLWLRQSRVVLEO\EHLQJWKHUHVXOWRIDZRUQEHOWGHFN ACTION &KHFNIRUDQH[FHVVLYHO\ZRUQEHOWGHFN Hardware I-Hits $KDUGZDUHFXUUHQWOLPLWRFFXUUHG1RVRIWZDUHDFWLRQRFFXUVRWKHUWKDQUHFRUGLQJ WKHHYHQWDPD[LPXPRIRQFHHYHU\PV7KHKDUGZDUHOLPLWVWKHFXUUHQWRQD F\FOHE\F\FOHEDVLV CAUSE $QH[FHVVLYHPRWRUFXUUHQWRYHUDZLOOFDXVHWKLVKLW ACTION $VLQWKHDERYH³+DUGZDUH,7ULSV´FRQGLWLRQFKHFNWKDWWKHPRWRUZLULQJLVQRW EHLQJVKRUWHG&KHFNWKDWWKHPRWRUSOXJDQGDOOLWVZLUHVDUHVHDWHGSURSHUO\ DQGWKDWWKHUHLVQRFRQWDPLQDWLRQRQWKHSLQV5XQWKHSKDVHWHVWWRLVRODWHD WURXEOHGSKDVHV  Line I-Hits 7KHOLQHFXUUHQWH[FHHGHGWKHDOORZDEOHOLPLW$QDSSURSULDWHPRWRUUSPGURSZLOO EHFRPPDQGHGWRWU\WRNHHSWKHFXUUHQWZLWKLQLWVOLPLW CAUSE Excessive motor current draw caused by a bad belt/deck or a high user weight FRPELQHGZLWKDKLJKVSHHG ACTION &KHFNIRUDQH[FHVVLYHO\ZRUQEHOWGHFN 135 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Main Motor Information (TR Only) LABEL DESCRIPTION Phase I-Hits The largest individual peak phase current has exceeded 17a; this is relatively TXLFNOLPLW$QDSSURSULDWHPRWRUUSPGURSZLOOEHFRPPDQGHGWRWU\WRNHHSWKH FXUUHQWZLWKLQLWVOLPLW CAUSE Users intentionally stomping on the belt can cause these and are considered QRUPDO([FHVVLYHPRWRUFXUUHQWGUDZFDXVHGE\DEDGEHOWGHFNRUDKLJKXVHU ZHLJKWFRPELQHGZLWKDKLJKVSHHG ACTION &KHFNIRUDQH[FHVVLYHO\ZRUQEHOWGHFN RMS I-Hits 7KHHIIHFWLYHPD[LPXPUPVFXUUHQWRIWKHPRWRUKDVH[FHHGHGD$Q appropriate motor rpm drop will be commanded to try to keep the current within LWVOLPLW CAUSE Excessive motor current draw caused by a bad belt/deck or a high user weight FRPELQHGZLWKDKLJKVSHHG ACTION &KHFNIRUDQH[FHVVLYHO\ZRUQEHOWGHFN Dynamic I-Hits One of the above occurred: Line I-Hits Phase I-Hits RMS I-Hits IC – Neg Switch Errors 7KHQHJDWLYHVZLWFKORJLFUHSRUWHGDQHUURU%HFDXVHRIQRLVHDQGWKHUPDOWULSVD IHZRFFXUUHQFHVDUHDFFHSWDEOH CAUSE An invalid combination of incline switch states occurred, or a timeout occurred JRLQJWRRUDZD\IURPWKHQHJDWLYHVZLWFK ACTION If a substantial amount (>9) of these are recorded, the negative switch and DVVRFLDWHGZLULQJVKRXOGEHFKHFNHG IC – Home Switch Errors 7KH+RPH6ZLWFKORJLFUHSRUWHGDQHUURU%HFDXVHRIQRLVHDQGWKHUPDOWULSVD IHZRFFXUUHQFHVDUHDFFHSWDEOH CAUSE An invalid combination of incline switch states occurred or a timeout occurred JRLQJWRRUDZD\IURPWKH+RPH6ZLWFK ACTION If a substantial amount (>9) of these are recorded, the Home Switch and DVVRFLDWHGZLULQJVKRXOGEHFKHFNHG 136 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Main Motor Information (TR Only) Maximums LABEL DESCRIPTION Motor Minutes 0RWRUUXQQLQJWLPHLQPLQXWHV Power & External Resets +RZPDQ\WLPHVWKH'63KDVJRQHWKRXJKDUHVHWRSHUDWLRQ COP Resets 7KHLQWHUQDO³FRPSXWHURSHUDWLQJSURSHUO\´ZDWFKGRJWLPHUGHWHFWHGDQ DEQRUPDOFRQGLWLRQDQGFDXVHGWKHV\VWHPWRUHVHW7KLVFDQRQO\RFFXUZKHQ UHSURJUDPPLQJDERDUGRUWHVWLQJDWWKHIDFWRU\2QO\Dfew VKRXOGHYHUEH VHHQ Phase V Max 7KHKLJKHVWPDJQLWXGHSHDNFXUUHQWPHDVXUHGLQSKDVH9 Phase W Max 7KHKLJKHVWPDJQLWXGHSHDNFXUUHQWPHDVXUHGLQSKDVH: Phase U Max 7KHKLJKHVWPDJQLWXGHSHDNFXUUHQWPHDVXUHGLQSKDVH8 NOTE: The above three should always be approximately the same within DSSUR[LPDWHO\D,IQRWWKHPRWRUSKDVHZLULQJDQGFRQQHFWRUVVKRXOGEH FKHFNHG Bus Voltage 7KHKLJKHVWYROWDJHPHDVXUHGRQWKHEXV$Q\WKLQJRYHUYLVDSRVVLEOH LQGLFDWLRQRIXVHUVGULYLQJWKHEHOWDWKLJKHULQFOLQHDQGKLJKHUVSHHG Max Frequency Delta 7KHVHDUHGLDJQRVWLFVIRUWKHPDQXIDFWXUHURQO\ Max Amplitude Delta A/D 3 Max A/D 6 Max A/D 7 Max Misc Item 1 Misc Item 2 Misc Item 3 137 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Lift Motor Information (TR Only) User Interface Object Table LABEL DESCRIPTION Readouts Incline Range and Lift Time:'LVSOD\WKHLQFOLQHUDQJHVDQGOLIWWLPHIURPWR ,IDSURGXFWRQO\VXSSRUWVSRVLWLYHLQFOLQHWKHUDQJHZLOOVKRZXSDVWR 7KHPD[LPXPDOORZDEOHLQFOLQHFDQEHVHWEHORZXVLQJWKH³0D[ ,QFOLQH´FRQ¿JXUDWLRQVHWWLQJLQWKH0DQDJHU¶V&RQ¿JXUDWLRQVFUHHQ/LIW7LPHVKRZV WKHWRWDOOLIWWLPH/LIW0RWRURQWLPH UHSRUWHGE\WKHPRWRUFRQWUROOHU7KHOLIWUDQJHVLH 7LPH VKRZVWKHDPRXQWRIWLPHDXVHUZRUNHGRXWLQWKHJLYHQLQFOLQHUDQJH Export To USB Button ([SRUWDOOWKHLQIRUPDWLRQRQWKHVFUHHQWRD86%VWLFNLQD&69FRPPDVHSDUDWHG YDOXH ¿OH Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX 138 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Belt / Deck Information (TR Only) User Interface Object Table LABEL DESCRIPTION Statistics Readouts Total Treadmill Hours:'LVSOD\WKHWRWDORSHUDWLQJKRXUV Total Treadmill Miles:'LVSOD\WKHWRWDORSHUDWLQJPLOHV Belt Hours:'LVSOD\WKHWRWDOEHOWRSHUDWLQJKRXUV Belt Miles:'LVSOD\WKHWRWDOEHOWRSHUDWLQJPLOHV Event History 'LVSOD\VDOOHYHQWVKLVWRU\LQIRUPDWLRQIRUEHOWDQGGHFN Export To USB Button ([SRUWDOOWKHLQIRUPDWLRQRQWKHVFUHHQWRD86%VWLFNLQD&69FRPPDVHSDUDWHG YDOXH ¿OH Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX NOTE:7KLVWHVWZLOOUHSRUWDQ\EHOWZHDUQRWL¿FDWLRQVYLDWKHSRSXSPHVVDJH³3OHDVH&KHFN%HOW'HFNIRU6LJQVRI ([FHVVLYH:HDU´7KLVPHVVDJHLVFOHDUHGRQFHLWKDVEHHQVKRZQ7KH(YHQW+LVWRU\ZLOOUHSRUWDQ\HYHQWVWKDWFDQ OHGWRDQRWL¿FDWLRQ7KHHYHQWFDQEHHLWKHUDVORZGRZQZKHUHXVHUZRXOGVHHWKH³8QDEOHWR$WWDLQ7DUJHW6SHHG´ RU DGLVWDQFHPLOHDJH EDVHGHYHQWZKHUHDQRWL¿FDWLRQLVLVVXHGGXHWRKLJK%HOW0LOHV :KHQDEHOWGHFNLVUHSODFHG D³5HSODFLQJ%HOWDQG'HFN´SURFHGXUHPXVWEHVXEPLWWHGLQWKH0DLQWHQDQFHVFUHHQIRUWKHEHOWZHDUQRWL¿FDWLRQ IHDWXUHWRFRQWLQXHWRZRUNSURSHUO\ 139 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Date and Time Information User Interface Object Table LABEL DESCRIPTION Date and Time Information Calendar: Shows the current system date and time Mode:,QGLFDWHVWKHFXUUHQWWLPHIRUPDWLQ+RXURU+RXUPRGH AM/PM:,QGLFDWHVWKHFXUUHQWWLPHLQ$030 Time Zone: Shows the set time zone for the system and allows user to view all DYDLODEOHWLPH]RQHIURPWKHGURSGRZQ Cancel Button &ORVHVWKH'DWHDQG7LPH,QIRUPDWLRQSRSXSDQGUHWXUQVWRWKHSUHYLRXVVFUHHQ 140 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: System Errors User Interface Object Table LABEL DESCRIPTION Error Readouts Error #: Displays the number of the error log (last/most recent error log is shown at the WRSRIWKHOLVW¿UVWHUURUORJZLOOEH(UURU  Type: Displays the type of error (see Details section for an expanded description of the HUURUW\SH  Occurrences:'LVSOD\VWKHQXPEHURIRFFXUUHQFHV Time Stamp:'LVSOD\VWKHGDWHDQGWLPHRIWKHRFFXUUHGHUURUV¿UVWDQGODVWHUURULI WKHUHKDVEHHQPRUHWKDQRQHRFFXUUHQFHRIWKHHUURU  Total System Errors:'LVSOD\VWKHWRWDOHUURUVUHJLVWHUHGE\WKHV\VWHP Details:'LVSOD\WKHHUURUGHWDLOV1RWHWKDWPDQ\GHWDLOVDUHIRUHQJLQHHULQJXVH8VH the scroll bar to the right of this area to scroll down to see additional details, if applicable Clear System Errors Button Displays a pass code entry pop-up and allows the user to enter a correct pass code HQWU\7KLVZLOODOORZWKHV\VWHPWRZLSHRXWDOOUHJLVWHUHGV\VWHPHUURUV Export To USB Button ([SRUWDOOWKHLQIRUPDWLRQRQWKHVFUHHQWRD86%VWLFNLQD&69FRPPDVHSDUDWHG YDOXH ¿OH Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX 141 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Maintenance Information User Interface Object Table LABEL DESCRIPTION Maintenance Information Readouts Repair #:'LVSOD\VWKHQXPEHURIUHSDLUV Type:'LVSOD\VWKHW\SHRIUHSDLUV Time Stamp:'LVSOD\VWKHGDWHDQGWLPHRIWKHRFFXUUHGUHSDLUV Total System Repairs:'LVSOD\VWKHWRWDOUHSDLUVUHJLVWHUHGE\WKHV\VWHP Details:'LVSOD\WKHUHSDLUGHWDLOV Clear System Repairs Button Displays a pass code entry pop-up and allows the user to enter a correct pass code HQWU\ZKLFKZLOODOORZWKHV\VWHPWRZLSHRXWDOOUHJLVWHUHGV\VWHPUHSDLUV Export To USB Button ([SRUWDOOWKHLQIRUPDWLRQRQWKHVFUHHQWRD86%VWLFNLQD&69FRPPDVHSDUDWHG YDOXH ¿OH Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX 142 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Usage Log Report User Interface Object Table LABEL DESCRIPTION Usage Log Readouts MPH: 'LVSOD\VDQGUHSRUWUHFRUGVRIVSHHGXVDJHLQPLOHSHUKRXUIURP±03+ Weight 0 – 400: Displays and report records of weight usage ranges from 0 – 400 SRXQGV Export To USB Button ([SRUWDOOWKHLQIRUPDWLRQRQWKHVFUHHQWRD86%VWLFNLQD&69FRPPDVHSDUDWHG YDOXH ¿OH Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX NOTE:7KLVORJUHSRUWVWKHQXPEHURIPLQXWHVDZRUNRXWKDVEHHQXVHGDWDJLYHQVSHHGUDQJHLHPSK ZRUNRXW VSHHGVEHWZHHQPSKWRPSKPSK WRPSKHWF DWDJLYHQXVHUZHLJKW 143 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: Channel Usage Log User Interface Object Table LABEL DESCRIPTION Channel Usage Log Readouts Channel Index:'LVSOD\VDQGUHSRUWUHFRUGVRIDOODYDLODEOHFKDQQHOV Channel Name:'LVSOD\VDQGUHSRUWWKHQDPHQXPEHURIDOODYDLODEOHFKDQQHOV Hours Watched: Displays and report the number of hours watched per channel for all DYDLODEOHFKDQQHOV Reset Hours Button 5HVHWVDOOWKHKRXUVZDWFKHGWR]HUR Export To USB Button ([SRUWDOOWKHLQIRUPDWLRQRQWKHVFUHHQWRD86%VWLFNLQD&69FRPPDVHSDUDWHG YDOXH ¿OH Back Button *RHVEDFNWRWKHSUHYLRXVVFUHHQ Main Menu Button *RHVEDFNWRWKH6\VWHP2SWLRQV±0DLQ0HQX 144 Appendix M051-00K65-A003 Engage / Inspire Console Diagnostic: &RQ¿JXUDWLRQ0HQX User Interface Object Table LABEL DESCRIPTION Manager Button 'LVSOD\VWKH0DQDJHU&RQ¿JXUDWLRQ6FUHHQ Manufacturer Button 'LVSOD\VWKH3DVV&RGH(QWU\VFUHHQ,IDYDOLGSDVVFRGHLVHQWHUHGWKHV\VWHPZLOO GLVSOD\WKH0DQXIDFWXUHU¶V&RQ¿JXUDWLRQVFUHHQ Video / FM Radio Button 'LVSOD\VWKH9LGHR)05DGLR&RQ¿JXUDWLRQ0HQX6FUHHQ Custom Workouts Buttons 'LVSOD\VWKH&XVWRP:RUNRXWV6HWXS6FUHHQ 7RXFK6FUHHQ&RQ¿JXUDWLRQ ([HFXWHVDQGGLVSOD\VWKH7RXFK6FUHHQ&DOLEUDWLRQSURJUDP Button Export / Import Settings Button 'LVSOD\VWKH([SRUW,PSRUW6HWWLQJV6FUHHQ VIVO / Network Button 'LVSOD\VWKH1HWZRUN&RQ¿JXUDWLRQ6FUHHQ Clock Button 'LVSOD\VWKH'DWHDQG7LPH,QIRUPDWLRQ6FUHHQ Create Your Own 'LVSOD\VWKH&UHDWH      24       24 !  ""#$%&  #$% '    22 '"   23 '"     ($  23 '"      &# 29      2:       2:   26 &  )    28 *   +  28  ,(  *-  2; ' * '      2;  + *%    ) . 2>  %     )  2< ' #   32 /+*$     32   + 0  33 )    + 39        3: 2 /++   36 &       36 *    1 3;  ( ** 3> 3 s ellaneo s s ellaneo s a t    be s     442 5(5%55% 5%5%5 46244786442 !+     443 55%5 786442344443 &# *  449 5(5% 5%5 786444364444 &# *  44: 5(5%55% 5%5%5 442;444323;:4  446 5(5%55% 5%5%5 442;442422;8<  #=>2>023,3-  448 5(5%55% 5%5%5 442;442422<43  #=802?448.8.034,;-  44; 5(5%55% 5%5%5 442;442422<6:  #=802?448.8.096,8-  44> 5(5%55% 5%5%5 442;442422<>:  #=2302?;68.8.094,28-  44< 5(5%55% 5%5%5 442;442422<69  #=802?448.8.02:,8>-  424 5(5%55% 5%5%5 442;442422;;8  #=2428@>,>-  422 5(5%55% 5%5%5 442;442422<<6  #=90?>8.8.024,:-  423 5(5%55% 5%5%5 442;4424:4:>> ($ =448?64,2<-  429 5(5%55% 5%5%5 442;4424:4:>< ($ =423?;4,28-  42: 5(5%55% 5%5%5 442;4444>434: 5 $+ A+   426 5(5%55% 5%5%5 442;4444>4346 5 $+ A4?6!B  (C ++    428 5(5%55% 5%5%5 442;4444>4348 5 $+ A4?99!B  42; 5(5%55% 5%5%5 442;444494<>4 '  A  ' #D *  42> 5(5%55% 5%5%5 442;444494;>2 '  A  &*$D *  42< 5(5%55% 5%5%5 442;4444948<8 '  A     &*$D * , ?-  434 5(5%55% 5%5%5 442;444494><4 /7  432 5(5%55% 5%5%5 442;444494<<8  E  433 5(5%55% 5%5%5 442;44449242: $ E  439 5(5% 5%5 4786422924444 '     43: 55%5 4786423<;4444 '     436 5(5%55% 5%5%5 442;442422<8>  #=:0?4;8.8.024,5 - +   5$ *$ $  %    +    )  * ? 9 e e oto oto sse bl : Part Numbers       442 5(5%55% 5%5%5 76>442;24443     443 5(5%55% 5%5%5 4786423324444  #$ #$ 449 5(5%55% 5%5%5 442;442422>>6 & 0  44: 55%5 442;444:32323 +,:- 446 5(5%55% 5%5%5 476>423684442    * 448 5(5%55% 5%5%5 476>4246;4442    44; 5(5%55% 5%5%5 442;442424999   # 44> 5(5%55% 5%5%5 476>423664444    *($ ,:- 44< 5(5%55% 5%5%5 442;4424:4:4< ($ ,:- 424 55%5 442;442422<:6 & 0 ,:- 49; 5(5% 5%5 442;442494999 ' ,:- 6 le sse bl an e elt 8 Part Numbers       422 5(5%55% 5%5%5 7864443<4444     423 5(5%55% 5%5%5 476>4222:4444  D   429 5(5%55% 5%5%5 4738434664444 + *+  42: 5(5%55% 5%5%5 476>424>64444 0  + * 426 5(5%55% 5%5%5 4786422294444    428 5(5%55% 5%5%5 442;44249493:  42; 5(5%55% 5%5%5 476>424>:4443 5$  $" 42> 5(5%55% 5%5%5 442;4444;43:> '  * 42< 5(5%55% 5%5%5 473842;924444    434 5(5%55% 5%5%5 442;442494999    * #,:- ; oto an a ets > Part Numbers       432 5(5% 5%5 786444>>4444    5 (   433 5(5% 5%5 442;4424:499:  ($ ,6- 439 5(5% 5%5 442;442422<>9    * ,6- 43: 5(5% 5%5 442;4424:448: ' ($ ,6- 436 5(5% 5%5 442;442422<>3    * ,3- 438 5(5% 5%5 442;4424:4:<3  ($ ,3- 43; 5(5% 5%5 4786422>;4444 5  43> 5(5% 5%5 442;442422<6<  5    *&#   43< 5(5% 5%5 442;442494999 ,:- 494 5(5% 5%5 442;4424:4999 ($ ,:- 492 5(5% 5%5 442;4424:4389 ($ ,:- 493 5(5% 5%5 47864229:4443 ' "       499 5(5%55% 5%5%5 442;442422<82    * #,:- 49: 5(5%55% 5%5%5 47864229:4442       496 5(5%55% 5%5%5 442;442422<82    * #,9- 498 5(5%55% 5%5%5 442;444:322:;   #.   < ase a e le t on s oto Cont olle Part Numbers       442 5(5%55 786444;2444;     %   %' # D * F 5%5% 5 786444;24424     %  %' # D * 443 5(5%55 786444;2444>     %   %&*$ D * F 5%5% 5 786444;24422     %  %&*$ D * 449 5(5%55% 5%5%5 442;442494964 & 0,9- 44: 5(5%55% 5%5%5 786444>34444       446 5(5%55% 5%5%5 442;444323>24 5+ )*$ * +  448 5(5%55% 5%5%5 442;444323>:8 5+     44; 5(5%55% 5%5%5 442;444323>:; $ G )  + 44> 5(5%55% 5%5%5 76>446394444 < # G+ "     %' ?  A)  "    #$ +  ? 24 n off t o e t an ne lte Part Numbers       44> 5(5%55% 5%5%5 442;442422<8> .   # 44>E 55%5 442;442424>>9 .   #,9- 44< 5(5%55% 5%5%5 442;4449342<6 &  #$ 424 5(5% 5%5 442;442494964    * 422 5(5%55% 5%5%5 442;4449342<> ! C!""#$ 423 5(5%55% 5%5%5 442;444494<:<  )  + 429 5(5%55% 5%5%5 442;442422<8<  )  +    * # 42: 5(5%55% 5%5%5 442;444492426 34+'   ,!- 426 5(5%55% 5%5%5 442;444494><> 24+'   ,5- 428 5(5%55% 5%5%5 442;442422<8> '      * #,3- 42; 5(5% 5%5 4786424>>4442 &  #$  22 ft ft ste a e an eels Part Numbers       '442 5(5% 5%5 4784424<34444 5   + '442E 55%5 ;963343 5   +,3- '443 5(5%55% 5%5%5 442;4424443:<  +) * '449 5(5%55% 5%5%5 4786423:64444 '"($ ,3- '44: 5(5% 5%5 442;4424949:< '"    *,3- '44:E 55%5 442;4424943>6 '"    *,3- '446 5(5% 5%5 442;442422<8: '"    * ,3- '446E 55%5 442;442422;;; '"    * ,3- '448 5(5% 5%5 4786423:34444   $ *,3- '448E 55%5 476>424><4444   $ *,3- '44; 5(5%55% 5%5%5 442;4424:436< ($ ,:- '44> 5(5% 5%5 786444><4442   '" (   '44>E 55%5 7864429;4444   '" (   23 ft oto an a ae Part Numbers       '44< 5(5%55% 5%5%5 442;444:322:;   #    '424 5(5%55% 5%5%5 442;4444;43;6 ) *.+ '422 5(5%55% 5%5%5 4786422<34442 '" 226D '423 5(5%55% 5%5%5 .78644443444< '" 394D '429 5(5%55% 5%5%5 442;44242349>   '42: 5(5%55% 5%5%5 442;44249443;  '426 5(5%55% 5%5%5 4786422964442 )      )*$ '428 5(5%55% 5%5%5 4786422964443 )      ' " '42; 5(5%55% 5%5%5 442;4424:44:9 ($ ,3- 29 Console sse bl Console a et an Co e s 2: Part Numbers       442 5(5%55% 5%5%5 786442944444  * (  CD7 443 5(5%55% 5%5%5 442;442422<<6     * #,:- 449 5(5%55% 5%5%5 4786422><4444 '     44: 5(5%55% 5%5%5 786444<44444 )     #C  446 5(5%55% 5%5%5 442;442422<69 )      #,3- 448 5(5%55% 5%5%5 442;442422<69  +  # 44; 5(5%55% 5%5%5 4786422>>4444   +  Consoles Part Numbers       44> 5(5%55% 5%5%5 '5!@@42 '5    = * $ 44< 5(5%55% 5%5%5 '55@@42 '5         424 5(5%55% 5%5%5 4;5!@@42 ; $' 5      422 5(5%55% 5%5%5 4;55@@42 ; $' 5      423 5(5%55% 5%5%5 265!@42 26 $' 5      5 429 5(5%55% 5%5%5 2655@42 26 $' 5    5 42: 5(5%55% 5%5%5 2655@42 26 $' 5    ' 26 ea t ate o a Co ste onents Part Numbers       &)442 5(5%55% 5%5%5 .786444434443 &)  7 &)443 5(5%55% 5%5%5 442;442422<>: * (     * # &)449 5(5%55% 5%5%5 7864423<4444 * (   &)44: 5(5%55% 5%5%5 47864234:4443  * . ,' "- &)446 5(5%55% 5%5%5 47864234:4442  * . ,)*$- &)448 5(5%55% 5%5%5 442;442422<6:    * #,:- &)44; 5(5%55% 5%5%5 442;4424:4:>>  ($ ,:- &)44> 5(5%55% 5%5%5 7864442:4444 *    &)44< 5(5%55% 5%5%5 4786423494442 ! * . ,)*$- &)424 5(5%55% 5%5%5 4786422994442 & )    . , - &)422 5(5%55% 5%5%5 4786422994443 & )    . ,- &)423 5(5%55% 5%5%5 4786423494443 ! * . ,' "- 28 t e al n e e ele ste sse bl Part Numbers       442 5(5%55% 5%5%5 786449;44444 ' *'     443 5(5%55% 5%5%5 442;442494999 & 0,:- 443E 55%5 442;442422<:6  ,:- 449 5(5%55% 5%5%5 476>424>94444 '    44: 5(5%55% 5%5%5 476>424<<4444  + 446 5(5%55% 5%5%5 476>422244444 '    448 5(5%55% 5%5%5 476>424<>4444   49; 5(5%55% 5%5%5 442;4424:4:8< ($ ,:- 2; e n s t e enso an olle a s Part Numbers       44; 5(5% 5%5 786444>44444 5 . 44> 5(5%55% 5%5%5 442;442494999 ,9- 44< 5(5%55% 5%5%5 442;4424:4:8< ($ ,6- 424 5(5% 5%5 442;4424:448: ' ($ ,3- 422 5(5% 5%5 442;442422<8;  ,3- 423 5(5% 5%5 442;4444<2362  #,3- 429 5(5% 5%5 .786444434442 ) .7 42: 5(5%55% 5%5%5 47:4424384443  + *,>- 426 5(5% 5%5 442;4424942<> 5   +,:- 428 5(5%55 76>446844444       42; 5(5%55% 5%5%5 442;442422863 + *   * #,>- 49> 5(5%55% 5%5%5 442;4424:44;3  ($ ,>- 49< 5(5%55 442;444:322>4  +$ * 4:4 5(5% 5%5 4786422<24444 (  *  ,3- 4:2 5(5% 5%5 786444;<4444 5 .'  4:3 5(5% 5%5 442;444:322:; .  ,3- 4:9 5(5% 5%5 442;442422;;8  #,3- 2> elt e an olle s 2< Part Numbers       42> 5(5%55 4786424434444  *  42>E 5(5%55 47864238;4444  * ,- 42>E  5%5%5 4786423;34444  *  42< 5(5%55 4786423894444   42>4 ) ) 5    438 5(5%55% 5%5%5 442;442424<;:    *  43; 5(5%55% 5%5%5 442;4424:44:9  ($  43> 5(5%55% 5%5%5 442;4424:4448 ' ($  43< 5(5%55% 5%5%5 7864448;4444  )      494 5(5%55%5 7864448;4442  )        492 5(5%55% 5%5%5 442;442422893 & 0 ,:- 493 5(5%55% 5%5%5 442;4424:4994  ($ ,:- 499 5(5%55% 5%5%5 476>422464444    49: 5(5%55% 5%5%5 4786422<64444  )    496 5(5%55%5 4786422<64442  )      498 55%5 442;4424:4446 ' ($ ,:- 34 o e a e ts an Co e s Part Numbers       '442 5(5%55% 5%5%5 4786422;:4442 +&  )*$ '443 5(5%55% 5%5%5 4786422;:4443 +&  ' " '449 5(5%55% 5%5%5 442;444:34938  .   '44: 5(5% 5%5% 4786422;84442 /+*$  ++  )*$ '446 5(5% 5%5% 4786422;84444 /+*$  ++  ' " '448 5(5%55% 5%5%5 47864223;4442 )*$/+*$   '44; 5(5%55% 5%5%5 47864223;4443 ' "/+*$   '44> 5(5%55% 5%5%5 442;442422;;8 /+*$     * #,:- '44< 5(5%55 .786444434424 )*$ ' "/+*$   '44: /+*$   * ,8- '422 5(5%55% 5%5%5 442;4424:4:>< ($ ,8- 32 nt sl a an t s ons Part Numbers       '423 5(5%55% 5%5%5 4786422<44442 )*$  + '429 5(5%55% 5%5%5 4786422<44443 ' "  + '42: 5(5%55% 5%5%5 .786444434449 )*$/++ 0 C  +7 '426 5(5%55% 5%5%5 .78644443444: ' "/++ 0 C  +7 '428 5(5%55% 5%5%5 786444<94449 )&' #  0    '42; 5(5%55% 5%5%5 786444<9444: '&' #  0    '42> 5(5%55% 5%5%5 47864236<4444 ' # 0 +  33 ea n Ca s Part Numbers       '42< 5(5%55% 5%5%5 .786444434439 )*$)   +7 '434 5(5%55% 5%5%5 442;442422;;8 )   +   * #,:- '432 5(5%55% 5%5%5 .786444434433 ' ")   +7 39 oto an Co e s Part Numbers       '433 5(5%55% 5%5%5 4786422384442        '439 5(5%55% 5%5%5 442;442422;;8    * #,:- '43: 5(5%55% 5%5%5 486422364444 5 +     '436 5(5%55% 5%5%5 442;442422;;8    * #,8- 3: e an a e a l an Co e s 36 Part Numbers       /442 5(5%55% 5%5%5 47864228;4442 )*$! &     /443 5(5%55% 5%5%5 442;442422<69 ! &     * # /449 5(5%55% 5%5%5 786444;;4442 )*$&     /44: 5(5%55% 5%5%5 4786423364444  &   * /446 5(5%55% 5%5%5 786442424444 * "24 * /448 5(5%55% 5%5%5 47864228>4442 )*$ &     /44; 5(5%55% 5%5%5 47864228>4443 ' " &     /44> 5(5%55% 5%5%5 442;442422<69 ! &     * # /44< 5(5%55% 5%5%5 786444;;4443 ' "&     /424 5(5%55% 5%5%5 47864228;4443 ' "! &     38 e Co e an t t one Part Numbers       /422 5(5%55% 5%5%5 4786424624444 5 +*    /423 5(5%55% 5%5%5 4786422;:4443 +&  ' " /429 5(5%55% 5%5%5 4786422;:4442 +&  )*$ /42: 5(5%55% 5%5%5 442;442422<6:    * #,3- /426 5(5%55% 5%5%5 786444264444 1    5(5%55% 5%5%5 786444264442 1    5(5%55% 5%5%5 864449;4444  +#$ 5 $    5(5%55% 5%5%5 7864449;4442  +#$ 5 $    /42; 5(5%55% 5%5%5 4786424634444   *    /42> 5(5%55% 5%5%5 4786424694444  B    /42< 5(5%55% 5%5%5 47864234>4444 *    /434 5(5%55% 5%5%5 442;442422<69 *      * #,24- F /428 F 3; PCST-DOMHX- n , a a s PCST-DOMLX- PCST-INTHX- PCST-DOMHX- PS le t 3>         '2 5(5%55% 5%5%5 786444:94442  AB  %(C   '3 5(5%55% 5%5%5 76>4449:4442 '9 5(5%55% 5 76>446844444 ': 5(5%55% 5%5%5 786444;:4444  A&  #$ '6 '  76>446334444  AG+ H # H'  '6E '   76>446394444  AG+ H # H'   '8 /     7;44449;4444  A/     ';    7864422;4444  A   #         A    5  0  '> 5(5%55% 5%5%5 786444:;4444  A'" +  *  '< 5(5%55% 5%5%5 786444;94444  A # 234D '24444  A  # " 5D '23 5(5%55% 5%5%5 786444<:4444  A     '29 5(5%55% 5%5%5 76>4433:4442  A!DH   '2: 5(5%55% 5%5%5 76>443894444  A& G+  '26 5(5%55% 5%5%5 738449:>4444  AG+ H.   '28 5(5%55% 5%5%5 786444624442  A H86 '2; 5(5%55% 5%5%5 786444834444  A 0).8% '2> 5(5%55% 5%5%5 793442844444  A#0#C  5(5%55% 5%5%5 7;2444344444 2  234D  # ++ #C'   3< , PCST-INHX- , PS PCST-DOMLX- 94         '2 5%5 786444:94442  A1  % (C  '3 5%5 76>4449:4442  A   #  '9 5%5 786444;:4444  A&  #$ ': '  76>446334444  AG+ H # H'  ':E '   76>446394444  AG+ H # H'   '6 /     7;44449;4444  A/     '8    7864422;4444  A    5  0  '; 5%5 786444:;4444  A'" +  *  '> 5%5 786444;94444  A # 234D '>E 5%5 786444;94442  A # 394D '< 5%5 786442264444  A234D  C  C #$9;?4F '24444  A  # " 5D  '22 5%5 786444<:4444  A    394D '22E 5%5 786444<:4442  A     234D '23 5%5 76>4433:4442  A!DH   '29 5%5 76>443894444  A& G+  '2: 5%5 738449:>4444  AG+ H.   '26 5%5 786444624442  A H86 '28 5%5 786444834444  A 0).8% '2; 5%5 793442844444  A#0#C  5%5 7;2444344444 2  234D  # ++ #C'  92