Preview only show first 10 pages with watermark. For full document please download

Imount®cylinder Pro-sound Packaged Speakers Lay-in & Grid-mount Drop Ceiling Speakers

   EMBED


Share

Transcript

iMount®Cylinder Pro-sound Packaged Speakers Exclusive — patented integral T-bar design. Lowell Host (LHR), Enclosed (LER) and Ganging (LGR) Electronic Racks & Accessories COMPAC™ Advanced Surge Suppression POWERSTAC™ Modular Power Lay-in & Grid-mount Drop Ceiling Speakers for Music, Paging & Sound-Masking UNIHORN® Paging Speaker August 7, 2010 ©2010-11 Lowell Manufacturing Company | 100 Integram Dr, Pacific, MO 63069 USA | ph. (800) 325-9660, (636) 257-3400 Table of Contents Electronic Racks Type Model (description) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Page I. FLOOR RACKS (stationary) LER-series (side & back panels, open front, adj. rails) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .06 A. Enclosed: LER-F-series (side & back panels, open front, fixed rails) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .08 B. Ganging: LGR-series (open frame, adj. rails) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .10 C. Network: LRR-series (open frame – for relay equipment) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .12 D. Laminated: LLR-series (solid top, base & sides, open front & back) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .12 II. SEISMIC-CERTIFIED™ A. Enclosed: Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .13 LSER-series (side & back panels, open front, adj. rails) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .14 LSER-F-series (side & back panels, open front, fixed rails) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .16 B. Ganging: LSGR-series (open frame, adj. rails) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .18 III. VARI-RACK® LVR-series (open frame, adj. depth) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .20 IV. PORTABLE RACKS A. Transport: LPR-series (enclosed rack with casters) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .22 B. Presentation: LPPR-2432 (boardroom quality enclosed rack with laminate top & casters) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .23 C. Studio: LPSR-F series (enclosed rack with sloped front & casters) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2 V. WALL-MOUNT RACKS & SHELVES LWBR-series (side & back panels, open front, platform base) A. Pivoting: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .24 B. Swing-out: LWR-series (side panels, top, base, sectional backbox) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .25 C. Stationary: LWR-F-series (side panels, wall-mount bracket, top & base) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .26 D. Tilt-out: LWTR-series (side panels, top, base, front) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .27 LWTCR-series (side panels, top, base, front with dampers) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .27 E. Shelves: FS-series (pre-assembled, ships flat, folds out) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .26 WS21-17 (back, base, angled sides) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .26 VI. PULL-OUT RACKS A. Built-in: LPTR-series (two-part design, open frame) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .28 B. Host: LHR-series (two-part design, exterior side panels, pull-out frame on turntable) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .29 VII. CREDENZA RACKS A. Built-in: B. Desk: VIII. RACK OPTIONS A. Doors LCR-1216 (welded frame) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .30 X-series (unassembled, open frame) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .30 LDR-series (top, base, side panels, open front & back) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .31 LDSR-series (top, bottom panels, side panels, open front (sloped) & back) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .31 Doors & Access Covers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .32 Dual-Door Frame . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .33 B. Side Panels (listed with individual rack models) C. Rails Rack Mounting Rails (also see specific rack models) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .35 D. Miscellaneous Cable Chase (raceway) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .34 Decorative Work Surface (rack top) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .35 Grounding Bus Bar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .34 Knockout / Project Panels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .35 Platform Bases . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .34 IX. RACKWARE® ACCESSORIES A. 19" EIA Panels Blank . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .36 Vented . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37 Security Covers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37 Panels with Device Cutouts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .38 Panels with Device Cutouts & Pocket-ID® . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .38 Panels with Device Cutouts, Pocket-ID® & Volume Controls . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .39 B. 19" EIA Shelves Utility . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .39 Shelves with Custom Face-Plate (RMK-series) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .40 Writing / Laptop . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .41 Keyboard / Monitor . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .41 Variable Depth or Variable Width . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .41 C. 19" EIA Storage Drawers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .42 Media Holders . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .42 D. Miscellaneous Rack Hardware . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .43 X. CABLE MANAGEMENT A. Horizontal 19" EIA Horizontal Rackmount Cable Managers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .44 B. Vertical Vertical Rackmount Cable Managers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .45 C. Bushings / Ties Bushings & Cable Wraps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .45 XI. THERMAL MANAGEMENT A. Fans 19" EIA Fan Panels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .46 02 B. Kit Single Fan Kit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .46 C. Thermostat Fan Thermostat Control . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .46 Power Type I. 19" EIA RACKMOUNT PANELS A. Stand-alone: Description . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Page 15A Corded . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .47 15A Hardwired . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .48 20A Corded . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .47 B. Remote Controls (contact closure): 15A Corded . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .48 15A Hardwired . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .48 20A Corded . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .48 C. Sequencing & Remote Controls: 15A Corded . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .49 20A Corded . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .49 Low Voltage . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .50 II. AC POWER STRIPS A. Single-circuit: 15A Corded . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .51 15A Hardwired . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .52 20A Corded . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .51 20A Hardwired . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .52 B. Multi-circuit: 15A Hardwired . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .52 20A Hardwired . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .52 C. Remote Control (single-circuit): 15A Corded . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .53 20A Hardwired . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .53 D. Remote Control (multi-circuit): 20A Hardwired . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .53 E. 240VAC 50/60 Hz 10A Hardwired . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .53 III. POWERSTAC™ A. Modular Power Strips: IV. ADVANCED SURGE SUPPRESSION A. Rackmount: Instructions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .54 Module Library . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .55 Module Prices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .56 Individual Replacement Modules . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .57 Panels with Advanced Surge Suppression . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .47 B. COMPAC™: 15A Corded . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .58 20A Corded . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .58 C. COMPAC™ STIC: 15A Corded . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .58 D. Ground Transient Filter (GTF): 20A Hardwired . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .59 E. Stand-alone: 20A Single-Circuit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .59 20A Multi-Circuit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .60 V. LOADCENTERS A. Single-phase with Control Unit: 100A . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .61 200A . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .61 B. Three-phase with Control Unit: 125A . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .61 225A . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .61 C. Sequence Control (only): 24-Circuit / 8-Step . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .61 D. Circuit Breakers (stab mount): Standard . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .62 Controlled . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .62 VI. SURFACE-MOUNT DEVICES A. Remote Controls: B. Sequencers: VII. SWITCHES A. Rackmount: 15A Corded . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .63 20A Corded . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .63 20A Hardwired . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .63 30A Hardwired . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .63 Low Voltage . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .63 Maintained Closure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .64 Momentary Closure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .64 B. Wall Plate: Maintained Closure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .65 Momentary Closure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .65 C. Replacement Keys: (for switches) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .64 D. Momentary Switch Module: Surface-mount . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .64 03 Audio Type Model (description) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Page I. PACKAGED SPEAKER SYSTEMS A. Open Architecture / Recessed Ceiling: iMount® (pro sound – 12" or 8") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .66 MDX (pro sound – 12") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .67 B. Open Architecture (only): iMount® Cylinder (pro sound – 12" or 8") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .67 C. Lay-in Drop Ceiling: LT (pro sound – 8", 6" or 4") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .68 LT (music/paging – 8"or 4") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .69 D. Recessed Ceiling: CN-Pro (music/paging – 8" or 6") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .70 CN-Pro-EL (music/paging – 8" or 6") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .70 RPAK (music/paging – 8") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .70 E. Surface: Wall-mount OS (high-fidelity indoor/outdoor music – 100W or 50W) . . . . . . . . . . . . . . . . . . . . . . . . . . . .71 DSL (music/paging – 8") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .71 DSQ (music/paging – 8") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .71 SL (music/paging – 8") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .72 F. Surface: Open Beam BC (music/paging – 8") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .72 G. Surface Horn: Unihorn® (paging – 8") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .73 LH (paging horns – 30W or 15W) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .72 II. UL 1480 GRILLE / SPEAKER / XFMR ASSEMBLIES A. Fire-Protective Signaling: B. General Signaling: III. GRILLE / SPEAKER ASSEMBLIES (+/- XFMR) A. Assembly with Round Grille B. Assembly with Square Grille ULD (8") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .74 ULS (8") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .74 ULT (4") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .74 WB (12", 8" or 4") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .75 8" or 4" . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .76 8" or 4" . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .76 IV. SOUND-MASKING A. Drop Ceiling: Lay-in LT (music, paging & sound-masking – 8") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .77 B. Drop Ceiling: Grid-mount SMTGM (formerly SMLT-series – 8" or 4") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .77 C. Above Ceiling: SM (8") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .78 D. Electronics: SMG (sound-masking generator) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .78 SMGA (sound-masking generator/amplifier) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .79 MP (19" rackmount monitor panels) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .79 TLM-600 (impedance matching transformer) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .79 V. SPEAKERS & COMPONENTS A. For 15-inch Speakers: B. For 12-inch Speakers: Speaker/Transformer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .80 Speaker . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .80 Grille . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .81 Backbox . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .81 Tile-Bridge & Support Channels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .81 C. For 8-inch Speakers: Speaker/Transformer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .82 Speaker . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .83 Grille . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .83 Surface Baffle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .84 Backbox . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .85 Tile-Bridge & Support Channels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .87 Recessed Mounting Rings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .87 D. For 6-inch Speakers: Speaker/Transformer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .87 Speaker . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .88 Grille . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .89 Backbox . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .88 Tile-Bridges& Support Channels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .89 E. For 4-inch Speakers: Speaker/Tranformer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .89 Speaker . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .90 Grille . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .91 Backbox . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .90 Tile-Bridge & Support Channels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .91 Recessed Mounting Rings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .91 F. Transformers: 20/20 AudioVision® . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .92 High Performance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .92 Standard . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .92 Dual Voltage . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .92 Impedance Matching . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .92 G. Hardware: Tinnerman Clips (8-32) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .92 VI. VOLUME CONTROLS A. Wall-mount: B. Rackmount: 04 Grille . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .80 Backbox . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .80 Mono: 100/70/25V (1-gang) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .93 Mono: 100/70/25V (2-gang) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .94 Mono: 1500 ohm L-pad (1-gang) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .94 Mono: 50, 5K, 10K ohm (1-gang) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .94 Stereo: 8 ohm (1-gang) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .95 Stereo: 100/70/25V (2-gang) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .95 Mono: 100/70/25V . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .95 Mono: 50, 5K, 10K ohm . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .96 Stereo: 100/70/25V . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .96 Stereo: 8 ohm . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .96 Volume Controls pre-loaded into Rackmount Panels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .96 Type VII. SOURCE SELECTOR SWITCHES A. Six-source: B. Six-source with Volume Control: VIII. MONITOR PANELS A. Rackmount: IX. ELECTRONIC ACCESSORIES A. Power Supply: Description . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Page Standard or Decora . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .97 Standard or Decora . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .97 MP (passive, active or amplified) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .98 General Purpose . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .99 B. Relay Modules: Standard (externally powered) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .99 Powered . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .99 C. Impedance-matching Transformer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .99 X. CLOCK / SPEAKER CENTERS A. Analog: Grille/Frame . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .100 Backbox . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .100 B. Digital: Grille/Frame . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .100 Backbox . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101 C. Modular: Grille/Frame Options . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101 Backbox . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101 XI. WALL & FLOOR BOXES / PLATES A. Floor: B. Wall: Alpha-numeric Model No. Index Floor Box . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .102 Carpet Trim Ring . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .102 Wall Box . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .102 Wall Plate (1-gang) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .102 Wall Plate (2-gang) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .102 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .103 05 RACK I: FLOOR RACKS (stationary) Enclosed Racks LER-series: LowellEnclosedRacksfeatureadjustablemountingrails,welded sidesandareardoor.Sidesanddoorareventedtopandbottom. Optionalfrontdoorcanbeorderedseparately.All-weldedconstructionwith100%certifiedU.S.steel.Bevelededgesonfourcorners. UL-Listedforloadsupto3150lbs.(1429kg).Blackwrinklepowder epoxyfinish.Features: Width: overallwidth:23.06" (586mm);railmountingwidth:19" EIA(483mm). Top: two16-gaugesteelpanels(3&4Uor3&7Udepending onrackdepth)createaflushclosurefortopofrack.Panelsare mountedtofrontofrackduringshippingtoprovideadditional stability.Topclosurepanelscanbereplacedwith(optional)fan panelsforactivethermalmanagement. Recessed Rear Door: vented(top/bottom)forpassiveheat dissipation.Includeslockandkey. Adjustable Mounting Rails: can be mounted anywhere (front-to-back)alongsiderailsupports.Printedscaleonrails facilitatesequipmentinstallation;dual-holepatternsupports multiplehardwarepreferences(10-32tapped-holeoptioncan befield-reversedtousesquareholesfor12-24,10-32or6mm screwswithcagenuts).Two-pairofmountingrailsareincluded with32" depthracks;shallowerracksinclude1-pair. Side Rail Supports: allowmountingrailstoberepositioned anywhere,front-to-back. Cable Management Features: Top:6" deeprearknockout plane;0.5" knockoutsalongsidesforBNCwirelessantennae. Bottom:opendesignincludesgroundinglugforcableaccess; rackwillaccept(optional)platformbase,leglevelersoranchors.Rear:knockoutpanelslocatedaboveandbelowrear doorfeaturemultipleloomingoptions. Hardware: PilotPoint™screwswithcaptivewashers(25-50). OPTIONS: Two 16-ga. steel closure panels fit together to provide flush closure for top of rack. Closure panels are included as standard equipment. Side rail supports allow mounting rails to be repositioned anywhere, front-to-back. Adjustable mounting rails can be repositioned anywhere along side rail supports. Mounting rails can be field-reversed to access squarepunched holes for alternate hardware needs. LER-4432 RACK: Removable knockout panels above and below rear door. Front Door (LFD-series): surface,steeldoorextends1" (25.5mm) fromframeandincludeslockandkey.Mountsleftorrightwithout drilling,fieldchangeable.180˚swing.Fourbevelededges.Black wrinklepowderepoxyfinish. Solid: singlepiececonstructionforstrengthanddurability. Plexiglas: steelframewithsmokedPlexiglasinsert. Fully-vented: allowspassiveheatdistribution. Dual-door: seeRackOptionsfordual-doorframe. Optional surface front door is available in solid steel, fully-vented steel, or steel frame with smoked Plexiglas insert. Additional Mounting Rails (RRD-series): mountingrailswith dual-holepattern.Soldinpairs.Includesmountinghardware. Platform Base: 14-gaugesteelbaseoptions: Stationary Base (LSB-series): mounts inside rack frame flushwithbottomofrackspacetosupportheavyequipment. Doesnotincreaserackheight. Shallow Stationary Base (LSSB-series): forshallow(22"/27" depth) racks. Base mounts inside rack frame creating a subfloorthat’s2.25" belowbottomofrackspace.Doesnot increaserackheight. Mobile Base (LMB-series): mountsinsiderackframeflush withbottomofrackspacetosupportheavyequipment.Adds 1.25" torackheight.3" swivelcasters(350lb.loadcapacityea.). Shallow Mobile Base (LMSB-series): cart mounts under rackframeflushwithbottomofrackspacetosupportheavy equipment. Adds 4.08" to rack height. 3" swivel casters— 2locking(350lb.loadcapacityeach). Open Back (-LRD suffix): toorderthisrackwithoutareardoor, selectthe“LRD”(lessreardoor)suffixinthemodelnumber. RACKWARE:® 06 AccessoriesarelistedunderRackware® Accessories,ThermalManagementandCableManagement. LSB LSSB LMSB LMB Fan panels for active heat dissipation, can be found in the Thermal Management section. Model No. Description RACKS LER-2122 LER-2422 LER-3522 LER-4022 LER-4422 LER-2127 LER-2427 LER-3527 LER-4027 LER-4427 LER-2432 LER-3532 LER-4032 LER-4432 Enclosed Rack Enclosed Rack Enclosed Rack Enclosed Rack Enclosed Rack Enclosed Rack Enclosed Rack Enclosed Rack Enclosed Rack Enclosed Rack Enclosed Rack Enclosed Rack Enclosed Rack Enclosed Rack RACKS LESS REAR DOOR LER-2122-LRD Enclosed Rack Less Rear Door LER-2422-LRD Enclosed Rack Less Rear Door LER-3522-LRD Enclosed Rack Less Rear Door LER-4022-LRD Enclosed Rack Less Rear Door LER-4422-LRD Enclosed Rack Less Rear Door LER-2127-LRD Enclosed Rack Less Rear Door LER-2427-LRD Enclosed Rack Less Rear Door LER-3527-LRD Enclosed Rack Less Rear Door LER-4027-LRD Enclosed Rack Less Rear Door LER-4427-LRD Enclosed Rack Less Rear Door LER-2432-LRD Enclosed Rack Less Rear Door LER-3532-LRD Enclosed Rack Less Rear Door LER-4032-LRD Enclosed Rack Less Rear Door LER-4432-LRD Enclosed Rack Less Rear Door OPTIONS LFD-21 LFD-24 LFD-35 LFD-40 LFD-44 LFD-21P LFD-24P LFD-35P LFD-40P LFD-44P LFD-21FV LFD-24FV LFD-35FV LFD-40FV LFD-44FV LSB-22 LSB-27 LSB-32 LSSB-22 LSSB-27 LMB-27 LMB-32 LMSB-22 RRD-21 RRD-24 RRD-35 RRD-40 RRD-44 Rack Units Overall D in. (mm) Former No. Overall H in. (mm) Usable D in. (mm) Carton Pack Carton Wt. lb. (kg) 21 24 35 40 44 21 24 35 40 44 24 35 40 44 22 (559) 22 (559) 22 (559) 22 (559) 22 (559) 27 (686) 27 (686) 27 (686) 27 (686) 27 (686) 32 (813) 32 (813) 32 (813) 32 (813) L265-36 L265-42 L265-61 L265-70 L265-77 L267-36 L267-42 L267-61 L267-70 L267-77 L268-42 L268-61 L268-70 L268-77 43 (1089) 48 (1222) 67 (1711) 76 (1934) 83 (2111) 43 (1089) 48 (1222) 67 (1711) 76 (1934) 83 (2111) 48 (1222) 67 (1711) 76 (1934) 83 (2111) 19 (491) 19 (491) 19 (491) 19 (491) 19 (491) 24 (618) 24 (618) 24 (618) 24 (618) 24 (618) 29 (745) 29 (745) 29 (745) 29 (745) 1 1 1 1 1 1 1 1 1 1 1 1 1 1 106 (48) 117 (53) 155 (70) 164 (74) 185 (84) 119 (54) 142 (64) 168 (76) 189 (86) 205 (93) 148 (67) 197 (89) 216 (98) 236 (107) 21 24 35 40 44 21 24 35 40 44 24 35 40 44 22 (559) 22 (559) 22 (559) 22 (559) 22 (559) 27 (686) 27 (686) 27 (686) 27 (686) 27 (686) 32 (813) 32 (813) 32 (813) 32 (813) L265-36ND L265-42ND L265-61ND L265-70ND L265-77ND L267-36ND L267-42ND L267-61ND L267-70ND L267-77ND L268-42ND L268-61ND L268-70ND L268-77ND 43 (1089) 48 (1222) 67 (1711) 76 (1934) 83 (2111) 43 (1089) 48 (1222) 67 (1711) 76 (1934) 83 (2111) 48 (1222) 67 (1711) 76 (1934) 83 (2111) 19 (491) 19 (491) 19 (491) 19 (491) 19 (491) 24 (618) 24 (618) 24 (618) 24 (618) 24 (618) 29 (745) 29 (745) 29 (745) 29 (745) 1 1 1 1 1 1 1 1 1 1 1 1 1 1 106 (48) 117 (53) 155 (70) 164 (74) 185 (84) 119 (54) 142 (64) 168 (76) 189 (86) 205 (93) 148 (67) 197 (89) 216 (98) 236 (107) Solid Front Door (for 21U rack) Solid Front Door (for 24U rack) Solid Front Door (for 35U rack) Solid Front Door (for 40U rack) Solid Front Door (for 44U rack) Plexiglas Front Door (for 21U rack) Plexiglas Front Door (for 24U rack) Plexiglas Front Door (for 35U rack) Plexiglas Front Door (for 40U rack) Plexiglas Front Door (for 44U rack) Fully-Vented Front Door (for 21U rack) Fully-Vented Front Door (for 24U rack) Fully-Vented Front Door (for 35U rack) Fully-Vented Front Door (for 40U rack) Fully-Vented Front Door (for 44U rack) Stationary Platform Base (for 22”D rack) Stationary Platform Base (for 27”D rack) Stationary Platform Base (for 32”D rack) Shallow Stationary Platform Base (for 22”D rack) Shallow Stationary Platform Base (for 27”D rack) Mobile Base (for 27”D rack) Mobile Base (for 32”D rack) Shallow Mobile Base (for 22”D rack) Rack Rails Dual-hole pattern (for 21U rack) Rack Rails Dual-hole pattern (for 24U rack) Rack Rails Dual-hole pattern (for 35U rack) Rack Rails Dual-hole pattern (for 40U rack) Rack Rails Dual-hole pattern (for 44U rack) L2150-36 L2150-42 L2150-61 L2150-70 L2150-77 L2150-36P L2150-42P L2150-61P L2150-70P L2150-77P L2150-36PF L2150-42PF L2150-61PF L2150-70PF L2150-77PF PB222 PB227 PB232 PBS222 PBS227 MB227 MB232 MBS222 L212-36 L212-42 L212-61 L212-70 L212-77 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1-pr 1-pr 1-pr 1-pr 1-pr 19 (9) 23 (10) 32 (15) 36 (16) 44 (19) 17 (8) 21 (10) 26 (12) 28 (13) 32 (15) 16 (7) 20 (9) 25 (11) 26 (12) 30 (14) 21 (10) 25 (11) 28 (13) 18 (8) 23 (10) 29 (13) 32 (15) 25 (11) 12 (5.5) 14 (6) 15 (7) 17 (8) 20 (9) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 07 LER-F series: Lowell Enclosed Racks with Fixed-rails provide an economical solutionforapplicationsthatwon’tneedtorepositionfrontmounting rails.Rackshaveweldedsidesandareardoor—allventedtopand bottom.Optionalfrontdoorcanbeorderedseparately.All-welded constructionfrom100%certifiedU.S.steel.Bevelededgesonfour corners.Mar-resistant,blackwrinklepowderepoxyfinish.UL-Listed. Features: Width: overallwidth:23.06" (586mm);railmountingwidth:19" EIA.(483mm). Top Panels: two16-gaugesteelpanels(either3U&4Uor3U &7U, dependingonrackdepth)createaflushclosurefortop ofrack.Panelsaremountedtofrontofrackduringshippingto provideadditionalstability.Topclosurepanelscanbereplaced with(optional)fanpanelsforactivethermalmanagement. Recessed Rear Door: ventedtopandbottomforpassive heatdissipation.Lockandkeyset. Fixed Mounting Rails: aremountedinafixed-positionatfront ofrack.Railsfeatureaprintedscaletofacilitateequipment installation.Dual-holepatternfeatures10-32tappedholesthat canbefield-reversedtosupportcagenutsmountedinsquare holesusing12-24,10-32or6mmscrews. Rear Mount Capability: racks will accept rear rails (RRDseries)mountedinafixedpositionatrearofrack,aswellas powerorwiremanagementaccessories.Orderseparately. Cable Management Features: Top:6" deeprearknockout plane;0.5" knockoutsalongsidesforBNCwirelessantennae. Bottom:opendesignincludesgroundinglugforcableaccess; rackwillaccept(optional)platformbase,leglevelersoranchors.Rear:knockoutpanelslocatedaboveandbelowrear doorfeaturemultipleloomingoptions. Hardware: PilotPoint™screwswithcaptivewashers(25-50). OPTIONS: Two 16-ga. steel closure panels fit together to provide flush closure for top of rack. Closure panels are included as standard equipment. Front mounting rails can be fieldreversed to access square-punched holes for alternate hardware needs. LER-F-4422 RACK: Removable knockout panels above and below rear door. Front Door (LFD-series): surface,steeldoorextends1" (25.4mm) fromframeandincludeslockandkey.Mountsleftorrightwithout drilling,fieldchangeable.180˚swing.Fourbevelededges.Black wrinklepowderepoxyfinish. Solid: singlepiececonstructionforstrengthanddurability. Plexiglas: steelframewithsmokedPlexiglasinsert. Fully-vented: allowspassiveheatdistribution. Dual-door: seeRackOptionssectionfordual-doorframe. Platform Base: 14-gaugesteelbaseoptions: Stationary Base (LSB-series): mounts inside rack frame flushwithbottomofrackspacetosupportheavyequipment. Doesnotincreaserackheight. Shallow Stationary Base (LSSB-series): forshallow(22"/27" depth)racks.Basemountsinsiderackframecreatingasubfloorthat’s2.25" belowbottomofrackspace.Doesnotincreaserackheight. Mobile Base (LMB-series): mountsinsiderackframeflush withbottomofrackspacetosupportheavyequipment.Adds 1.25" torackheight.3" swivelcasters(350lb.loadcapacityea.). Shallow Mobile Base (LMSB-series): cart mounts under rackframeflushwithbottomofrackspacetosupportheavy equipment.Adds4.08" torackheight.3" swivelcasters—2 locking(350lb.loadcapacityeach). Additional Mounting Rails (RRD-series): mounting rails with dual-holepattern(tapped10-32on1side,square-punched12-24, 10-32, and 6mm on alternate side) can be mounted in rear of LER-Fseriesracks.Soldinpairs.Includesmountinghardware. Optional front door is available in solid steel, fully-vented steel, or steel frame with smoked Plexiglas insert. LSB LSSB LMSB LMB Open Back (-LRD suffix): toorderarackwithoutareardoor,use the“LRD”(lessreardoor)suffixinthemodelnumber. RACKWARE:® 08 AccessoriesarelistedunderRackware® Accessories,ThermalManagementandCableManagement. Fan panels for active heat dissipation, can be found in the Thermal Management section. Model No. Description RACKS LER-F2122 LER-F2422 LER-F3522 LER-F4022 LER-F4422 LER-F2127 LER-F2427 LER-F3527 LER-F4027 LER-F4427 Enclosed Rack Fixed-rails Enclosed Rack Fixed-rails Enclosed Rack Fixed-rails Enclosed Rack Fixed-rails Enclosed Rack Fixed-rails Enclosed Rack Fixed-rails Enclosed Rack Fixed-rails Enclosed Rack Fixed-rails Enclosed Rack Fixed-rails Enclosed Rack Fixed-rails RACKS LESS REAR DOOR LER-F2122-LRD Enclosed Rack Fixed-rails Less Rear Door LER-F2422-LRD Enclosed Rack Fixed-rails Less Rear Door LER-F3522-LRD Enclosed Rack Fixed-rails Less Rear Door LER-F4022-LRD Enclosed Rack Fixed-rails Less Rear Door LER-F4422-LRD Enclosed Rack Fixed-rails Less Rear Door LER-F2127-LRD Enclosed Rack Fixed-rails Less Rear Door LER-F2427-LRD Enclosed Rack Fixed-rails Less Rear Door LER-F3527-LRD Enclosed Rack Fixed-rails Less Rear Door LER-F4027-LRD Enclosed Rack Fixed-rails Less Rear Door LER-F4427-LRD Enclosed Rack Fixed-rails Less Rear Door OPTIONS LFD-21 LFD-24 LFD-35 LFD-40 LFD-44 LFD-21P LFD-24P LFD-35P LFD-40P LFD-44P LFD-21FV LFD-24FV LFD-35FV LFD-40FV LFD-44FV LSB-22 LSB-27 LSSB-22 LSSB-27 LMB-27 LMSB-22 RRD-21 RRD-24 RRD-35 RRD-40 RRD-44 Solid Front Door (for 21U rack) Solid Front Door (for 24U rack) Solid Front Door (for 35U rack) Solid Front Door (for 40U rack) Solid Front Door (for 44U rack) Plexiglas Front Door (for 21U rack) Plexiglas Front Door (for 24U rack) Plexiglas Front Door (for 35U rack) Plexiglas Front Door (for 40U rack) Plexiglas Front Door (for 44U rack) Fully-Vented Front Door (for 21U rack) Fully-Vented Front Door (for 24U rack) Fully-Vented Front Door (for 35U rack) Fully-Vented Front Door (for 40U rack) Fully-Vented Front Door (for 44U rack) Stationary Base (for 22D rack) Stationary Base (for 27D rack) Shallow Stationary Base (for 22D rack) Shallow Stationary Base (for 27D rack) Mobile Base (for 27D rack) Mobile Shallow Base (for 22D rack) Rack Rails Dual-hole pattern (for 21U rack) Rack Rails Dual-hole pattern (for 24U rack) Rack Rails Dual-hole pattern (for 35U rack) Rack Rails Dual-hole pattern (for 40U rack) Rack Rails Dual-hole pattern (for 44U rack) Rack Units Overall D in. (mm) Former No. Overall H in. (mm) Usable D in. (mm) 21 24 35 40 44 21 24 35 40 44 22 (559) 22 (559) 22 (559) 22 (559) 22 (559) 27 (686) 27 (686) 27 (686) 27 (686) 27 (686) L260-36 L260-42 L260-61 L260-70 L260-77 L262-36 L262-42 L262-61 L262-70 L262-77 43 (1089) 48 (1222) 67 (1711) 76 (1934) 83 (2111) 43 (1089) 48 (1222) 67 (1711) 76 (1934) 83 (2111) 19 (491) 19 (491) 19 (491) 19 (491) 19 (491) 24 (618) 24 (618) 24 (618) 24 (618) 24 (618) 1 1 1 1 1 1 1 1 1 1 100 (45) 110 (50) 153 (69) 172 (78) 182 (83) 110 (50) 128 (58) 162 (73) 180 (82) 195 (88) 21 24 35 40 44 21 24 35 40 44 22 (559) 22 (559) 22 (559) 22 (559) 22 (559) 27 (686) 27 (686) 27 (686) 27 (686) 27 (686) L260-36ND L260-42ND L260-61ND L260-70ND L260-77ND L262-36ND L262-42ND L262-61ND L262-70ND L262-77ND 43 (1089) 48 (1222) 67 (1711) 76 (1934) 83 (2111) 43 (1089) 48 (1222) 67 (1711) 76 (1934) 83 (2111) 19 (491) 19 (491) 19 (491) 19 (491) 19 (491) 24 (618) 24 (618) 24 (618) 24 (618) 24 (618) 1 1 1 1 1 1 1 1 1 1 100 (45) 110 (50) 153 (69) 172 (78) 182 (83) 110 (50) 128 (58) 162 (73) 180 (82) 195 (88) 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1-pr 1-pr 1-pr 1-pr 1-pr 19 (9) 23 (10) 32 (15) 36 (16) 44 (19) 17 (8) 21 (10) 26 (12) 28 (13) 32 (15) 16 (7) 20 (9) 25 (11) 26 (12) 30 (14) 21 (10) 25 (11) 18 (8) 23 (10) 29 (13) 25 (11) 12 (5.5) 14 (6) 15 (7) 17 (8) 20 (9) L2150-36 L2150-42 L2150-61 L2150-70 L2150-77 L2150-36P L2150-42P L2150-61P L2150-70P L2150-77P L2150-36PF L2150-42PF L2150-61PF L2150-70PF L2150-77PF PB222 PB227 PBS222 PBS227 MB227 MBS222 L212-36 L212-42 L212-61 L212-70 L212-77 Carton Carton Wt. Pack lb. (kg) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45 mm). 09 Ganging Racks LGR series:   OPTIONS: LowellGangingRacksaredesignedtolinktogetherformultiplerackapplications.Gangingracksfeatureopensidestofacilitateaccess to wires and cable bundles. All-welded construction adds strengthanddurability.Load-testedto3500lbs.(1588kg).Racks includeplentiful,pre-drilledholesforwirelooming,bevelededges on4corners,andablackwrinklepowderepoxyfinish.UL-Listed. Features: Width: overall:23.06" (586mm);rail-mountingwidth:19" EIA (483mm). Top: (2)16-ga.steelpanels(3U&4Uor3U&7Udepending onrackdepth)createflushclosurefortopofrack.Panelsare mountedtofrontofrackduringshippingtoprovideadditional stability.Topclosurepanelscanbereplacedwith(optional)fan panelsforactivethermalmanagement. Recessed Rear Door: ventedtopandbottomforpassive heatdissipation,locking. Adjustable Mounting Rails: canbeadjustedtomountanywhere(front-to-back)alongsiderailsupports.Printedscaleon eachrailfacilitatesequipmentinstallationwhilethedual-series holepatternsupportsmultiplehardwarepreferences.Pre-set 10-32tapped-holeoptioncanbefield-reversedtousesquare holesfor12-24,10-32or6mmscrewswithcagenuts.Shallow (22"D)racksinclude1-pairofrails;otherdepthsinclude2-pair. Side Rail Supports: provideaplatformformountingrailsto bepositionedanywhere,front-to-back. Cable Management Features: Top:6" deeprearknockout plane;0.5”knockoutsalongsidesforBNCwirelessantennae. Bottom:opendesignincludesgroundinglugforcableaccess; accepts(optional)platformbase,levelersoranchors.Rear: knockoutpanelslocatedaboveandbelowreardoorfeature multipleloomingoptions. Hardware: PilotPoint™screwswithcaptivewashers(25-50). Two 16-ga. steel closure panels fit together to provide flush closure for top of rack. Panels are included as standard equipment. Adjustable mounting rails can be repositioned anywhere along side rail supports. Mounting rails can be field-reversed to access squarepunched holes for alternate hardware needs. LGR-4432 RACK: Removable knockout panels above and below rear door. Side Panels (-SP suffix): 16-ga.steelpanels,ventedtopandbottom withcenterhandgrips.Securewithscrews(provided).Blackwrinkle finish.Soldinpairs. Cable Chase (LCC4-series): 4" wideracewayconnectsracksor rackand(optional)sidepanel. Additional Mounting Rails (RRD-series): seeRackOptions. Front Door (LFD-series): surface,16-ga.steeldoorextends1" from frameandincludeslockandkey.Mountsleftorrightwithoutdrilling,field changeable.180˚swing.Fourbevelededges.Blackwrinklefinish. Solid: singlepiececonstructionforstrengthanddurability. Plexiglas: steelframewithsmokedPlexiglasinsert. Fully-vented: allowspassiveheatdistribution. Dual-door: seeRackOptionssectionfordual-doorframe. Platform Base: 14-gaugesteelbaseoptions: Stationary Base (LSB-series): mountsinsiderackframeflush withbottomofrackspacetosupportheavyequipment.Does notincreaserackheight. Shallow Stationary Base (LSSB-series): forshallow(22"/27") racks.Basemountsinsiderackframecreatingasubfloorthat’s 2.25" belowbottomofrackspace.Doesnotincreaserackheight. Mobile Base (LMB-series): mountsinsiderackframeflush withbottomofrackspacetosupportheavyequipment.Adds 1.25" torackheight.3" swivelcasters(350lb.loadcapacityea.). Shallow Mobile Base (LMSB-series): cartmountsunder rackframeflushwithbottomofrackspacetosupportheavy equipment.Adds4.08" torackheight.3" swivelcasters—2 locking(350lb.loadcapacityeach). LFD-series front door is available in solid steel, fully-vented steel, or steel frame with smoked Plexiglas insert. LMSB LMB LSB Open Back (-LRD suffix): toorderarackwithoutareardoor,select the“LRD”(lessreardoor)suffixinthemodelnumber. RACKWARE:® 10 AccessoriesarelistedunderRackware® Accessories,ThermalManagementandCableManagement. LCC4 LSSB Optional vented side panels with center hand-grips. Model No. Description Rack Units RACKS Ganging Rack 35 LGR-3522 LGR-4022 Ganging Rack 40 LGR-4422 Ganging Rack 44 LGR-2427 Ganging Rack 24 LGR-3527 Ganging Rack 35 LGR-4027 Ganging Rack 40 LGR-4427 Ganging Rack 44 LGR-3532 Ganging Rack 35 LGR-4032 Ganging Rack 40 LGR-4432 Ganging Rack 44 LGR-4036 Ganging Rack 40 LGR-4436 Ganging Rack 44 RACKS LESS REAR DOOR LGR-3522-LRD Ganging Rack Less Rear Door 35 LGR-4022-LRD Ganging Rack Less Rear Door 40 LGR-4422-LRD Ganging Rack Less Rear Door 44 LGR-2427-LRD Ganging Rack Less Rear Door 24 LGR-3527-LRD Ganging Rack Less Rear Door 35 LGR-4027-LRD Ganging Rack Less Rear Door 40 LGR-4427-LRD Ganging Rack Less Rear Door 44 LGR-3532-LRD Ganging Rack Less Rear Door 35 LGR-4032-LRD Ganging Rack Less Rear Door 40 LGR-4432-LRD Ganging Rack Less Rear Door 44 LGR-4036-LRD Ganging Rack Less Rear Door 40 LGR-4436-LRD Ganging Rack Less Rear Door 44 OPTIONS LFD-24 Solid Front Door (for 24U rack) LFD-35 Solid Front Door (for 35U rack) LFD-40 Solid Front Door (for 40U rack) LFD-44 Solid Front Door (for 44U rack) LFD-24P Plexiglas Front Door (for 24U rack) LFD-35P Plexiglas Front Door (for 35U rack) LFD-40P Plexiglas Front Door (for 40U rack) LFD-44P Plexiglas Front Door (for 44U rack) LFD-24FV Fully-Vented Front Door (for 24U rack) LFD-35FV Fully-Vented Front Door (for 35U rack) LFD-40FV Fully-Vented Front Door (for 40U rack) LFD-44FV Fully-Vented Front Door (for 44U rack) LGR-2427-SP Side Panels (for LGR-2427) LGR-3522-SP Side Panels (for LGR-3522) LGR-3527-SP Side Panels (for LGR-3527) LGR-3532-SP Side Panels (for LGR-3532) LGR-4022-SP Side Panels (for LGR-4022) LGR-4027-SP Side Panels (for LGR-4027) LGR-4032-SP Side Panels (for LGR-4032) LGR-4036-SP Side Panels (for LGR-4036) LGR-4422-SP Side Panels (for LGR-4422) LGR-4427-SP Side Panels (for LGR-4427) LGR-4432-SP Side Panels (for LGR-4432) LGR-4436-SP Side Panels (for LGR-4436) LCC4-4422 Cable Chase 4”W (for 44U x 22D rack) LCC4-4427 Cable Chase 4”W (for 44U x 27D rack) LCC4-4432 Cable Chase 4”W (for 44U x 32D rack) LCC4-4436 Cable Chase 4”W (for 44U x 36D rack) LSB-22 Stationary Base (for 22D rack) LSB-27 Stationary Base (for 27D rack) LSB-32 Stationary Base (for 32D rack) LSB-36 Stationary Base (for 36D rack) LSSB-22 Shallow Stationary Base (for 22D rack) LSSB-27 Shallow Stationary Base (for 27D rack) LMB-27 Mobile Base (for 27D rack) LMB-32 Mobile Base (for 32D rack) LMB-36 Mobile Base (for 36D rack) LMSB-22 Mobile Shallow Base (for 22D rack) Overall D in. (mm) Former No. Overall H in. (mm) Usable D in. (mm) Carton Pack Carton Wt. lb. (kg) 22 (559) 22 (559) 22 (559) 27 (686) 27 (686) 27 (686) 27 (686) 32 (813) 32 (813) 32 (813) 36 (914) 36 (914) L275-61 L275-70 L275-77 L277-42 L277-61 L277-70 L277-77 L278-61 L278-70 L278-77 L279-70 L279-77 67 (1711) 76 (1934) 83 (2111) 48 (1222) 67 (1711) 76 (1934) 83 (2111) 67 (1711) 76 (1934) 83 (2111) 76 (1934) 83 (2111) 19 (491) 19 (491) 19 (491) 24 (618) 24 (618) 24 (618) 24 (618) 29 (745) 29 (745) 29 (745) 33 (847) 33 (847) 1 1 1 1 1 1 1 1 1 1 1 1 127 (58) 137 (62) 150 (68) 140 (64) 149 (68) 161 (73) 181 (82) 165 (75) 176 (80) 188 (85) 176 (80) 198 (90) 22 (559) 22 (559) 22 (559) 27 (686) 27 (686) 27 (686) 27 (686) 32 (813) 32 (813) 32 (813) 36 (914) 36 (914) L275-61ND L275-70ND L275-77ND L277-42ND L277-61ND L277-70ND L277-77ND L278-61ND L278-70ND L278-77ND L279-70ND L279-77ND 67 (1711) 76 (1934) 83 (2111) 48 (1222) 67 (1711) 76 (1934) 83 (2111) 67 (1711) 76 (1934) 83 (2111) 76 (1934) 83 (2111) 19 (491) 19 (491) 19 (491) 24 (618) 24 (618) 24 (618) 24 (618) 29 (745) 29 (745) 29 (745) 33 (847) 33 (847) 1 1 1 1 1 1 1 1 1 1 1 1 127 (58) 137 (62) 150 (68) 140 (64) 149 (68) 161 (73) 181 (82) 165 (75) 176 (80) 188 (85) 176 (80) 198 (90) 1 1 1 1 1 1 1 1 1 1 1 1 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1 1 1 1 1 1 1 1 1 1 1 1 1 1 23 (10) 32 (15) 36 (16) 44 (19) 21 (10) 26 (12) 28 (13) 32 (15) 20 (9) 25 (11) 26 (12) 30 (14) 73 (33) 63 (29) 78 (35) 90 (41) 55 (25) 87 (39) 100 (45) 114 (52) 77 (35) 96 (43) 108 (49) 122 (55) 21 (10) 22 (10) 23 (10) 24 (11) 21 (10) 25 (10) 28 (13) 35 (16) 18 (8) 23 (10) 29 (13) 32 (15) 39 (18) 25 (11) L2150-42 L2150-61 L2150-70 L2150-77 L2150-42P L2150-61P L2150-70P L2150-77P L2150-42PF L2150-61PF L2150-70PF L2150-77PF L277-42SP L275-61SP L277-61SP L278-61SP L275-70SP L277-70SP L278-70SP L279-70SP L275-77SP L277-77SP L278-77SP L279-77SP L275-77CR L277-77CR L278-77CR L279-77CR PB222 PB227 PB232 PB236 PBS222 PBS227 MB227 MB232 MB236 MBS222 Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 11 Network Racks LRR-series: RACK: LowellRelayRacksaredesignedtohousevoice/datacablesin commercialsound,broadcastandtelecommunicationapplications wherefullaccesstoelectronicsisrequired.Verticalchannelsare3" wideandformedfrom11-ga.steel.Channelsincludemounting holes(tapped10-32)onEIAmountingcenters.Baseandtopangle supportsaremadefrom2-piecealuminumconstruction.Basefeatures4pre-drilledholestosecuretheracktothefloor,whenneeded forcode-compliance.Blackpowderepoxyfinish.Shipsunassembled.Features: LRR racks ship unassembled (assembly hardware is included). Cable management rods and panels are sold separately. Width: overallwidth:20.25" (514.35mm);rail-mountingwidth: 19" EIA(483mm) Base Depth: 15" (381mm) Hardware: assemblyandpanelmountinghardware. RACKWARE:® AccessoriesarelistedunderRackware® Accessories,ThermalManagementandCableManagement. Model No. Description LRR-3815 LRR-4515 Relay Rack Relay Rack Ships via Rack Units Overall D in. (mm) Former No. Overall H in. (mm) Carton Pack Carton Wt. lb. (kg) 38 45 15 (381) 15 (381) L280-63 L280-78 72 (1829) 84 (2134) 1 1 40 (18) 44 (20) Laminated Racks LLR-series: RACK: LowellLaminatedRacksfeatureablack,wood-laminateexteriorthat presentsaboardroomquality,furniture-gradeappearance.Phillipsheadcamsanddowelsinstallfromtheinsideandincludeablack coversothere’snovisiblehardwareontheexterioroftherack.Steel mountingrails(11ga.)arepre-installedinfrontpanelspace.Railsfeatureaprintedscaletosimplifyequipmentsetup.Sides,topandbottom are made from sturdy wood composite (0.62"/15.87mm). Cathedralblack,woodgrainfinish.Unassembled.Features: Width: overallwidth:20.35" (517mm);rail-mountingwidth:19" EIA(483mm)   Depth: overall depth: 18" (457mm), usable depth: 17.5" (444.5mm) Fixed Mounting Rails: 11-gaugesteel,tapped10-32,1-pair Assembly Hardware: Phillips-headcams,dowelsandcaps installwithoutspecialtools. Laminated black wood finish provides an attractive, boardroom-quality finish. Panel Hardware: PilotPoint™screwswithcaptivewashers. OPTIONS: Additional Mounting Rails (LLR-RRT series): extramountingrails for the LLR-series provide additional support for rackmounted equipment. Rails (tapped 10-32) mount to pre-drilled holes in panels.Soldinpairs;includesscrews. Model No. RACKS LLR-1018-B LLR-1218-B LLR-1618-B LLR-2118-B OPTIONS LLR-RRT-10 LLR-RRT-12 LLR-RRT-16 LLR-RRT-21 12 Rack Units Overall D in. (mm) Former No. Laminated Rack, Black Laminated Rack, Black Laminated Rack, Black Laminated Rack, Black 10 12 16 21 18 (457) 18 (457) 18 (457) 18 (457) LR1018-B LR1218-B LR1618-B LR2118-B LLR Rack Rails (Thin-flange) LLR Rack Rails (Thin-flange) LLR Rack Rails (Thin-flange) LLR Rack Rails (Thin-flange) 10 12 16 21 Description LR-RRK10 LR-RRK12 LR-RRK16 LR-RRK21 Additional mounting rails provide extra support for rackmounted equipment. Overall H in. (mm) 18.9 (480.06) 22.4 (568.96) 29.4 (746.76) 38.15 (969.01) Carton Pack Racks ship via Carton Wt. lb. (kg) 1 1 1 1 36 (16) 38 (17) 46 (21) 52 (24) 1 1 1 1 3 (1.5) 4 (2) 5 (2.5) 6 (3) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). RACK II: SEISMIC-CERTIFIED RACKS SEISMIC-CERTIFICATION:Seismic-certificationforfloorracksfallsintotwobasiccategories: CATEGORY 1: ANCHORAGE: provisionsthatmeetlifesafetyrequirementsforprotecting building occupants from the danger of racks falling over or obstructing egressroutesduringaseismicevent.ThiscertificationisrequiredbytheCalifornia Building Code (CBC) and International Building Code (IBC) for installationsinmoderatetohighseismicregions.It’salsorequiredbytheOfficeofStatewideHealthPlanningandDevelopmentforCalifornia(OSHPD). CATEGORY 2: ANCHORAGE & RACK: structureprovisionsthatmeetlifesafetyrequirements(listedabove)plusthosefor“EssentialFacilities”wherethesurvival andoperabilityofcriticalequipment,followingaseismicevent,isrequired. Thismorestringentcertification(ANCHORAGE&RACK)isrequiredbythe IBCforinstallationsinmoderateandhighseismicregionsthataredeemed “Essential”oras“DesignatedSeismicSystems”andhaveanImportance Factorof1.5(includingmedical,fire,police,telecommunicationsandother criticalpublic,private,governmentandinstitutionalfacilities). IBC QUALIFIER BRACE: dependingontheseismicregion,somerack installationsrequireIBCQualifierBraces,inadditiontoanchoring,tomeet ANCHORAGE&RACKqualification.Therequirementforbracesisbasedon theprojectsitespectralacceleration(Ss)andtheinstalledlocationinthe building(lower,middleorupperthird)foreachspecificrackmodel.Thespectral acceleration, Ss, is specified in the building structural design drawingsorgeotechnicalreport.IBCQualifierBracesarespeciallyfabricated panelsthatarefactory-installedtocertifiedhardware/torquespecifications indesignatedlocationsonthefrontandrearmountingrails.Bracesand mountingrailsmustremaininfactory-installedlocations(mountingrailsin full-frontandfull-rearpositions)tomaintainIBCQualification. LOWELL RACKS: Lowellseismic-certifiedrackshaveundergonerigorousanalysistoreceive ProfessionalEngineer(P.E.)CertificationforANCHORAGEandANCHORAGE &RACKstructures,pertheIBC(1613.1/ASCE/SEI-7-05section13.2.11621 forracksinstalledinbuildingswithanImportanceFactorof1.5essentialor anImportanceFactorof1.0non-essential).Eachseismic-certifiedrackincludesaP.E.-CertifiedInstallationDocumentPackagethatprovidesinformationonhowtoinstalltherackforcodecompliance. Rack models with IBC Qualification for ANCHORAGE & RACK structure (LSGR and LSER-series with adjustable rails) include a P.E.-Certified Document Package for IBC ANCHORAGE & RACK QUALIFICATION – ESSENTIALFACILITIES.ThedocumentationisP.E.-CertifiedtomeetIBC 2009requirementsandsatisfiestechnical,seismicandqualityassurancerequirementsoftheIBCforessentialandnon-essentialfacilitieswithanImportance Factor of 1.5 and spectral acceleration up to 3.0 g's. The documentationpackagemayprecludethenecessityofhavingastructural engineerperformadditionalseismiccalculationsforeachracklocationor generateadditionalqualityassurancedocumentation(suchasseismiccalculations,installationdrawings,oraqualityassuranceplanforspecialinspections)requiredbythebuildingofficialorAuthorityHavingJurisdiction. Documentationpackagesareavailable,freeofcharge,toevaluateorsubmit toapplicableauthoritiesforfinalapproval. LSGR LSER LSER-F Seismic-certified racks include P.E.-Certified documentaion. Some applications require IBC Qualifier Braces (available in 1, 2 or 4-pair). Braces are ordered separately & must be factory-installed. RACK SELECTION: 1.Identifyrackstyle,heightanddepthneeded. 2. Determine applicable building code and certification needed (nonessential Ip=1.0 “ANCHORAGE” or essential Ip=1.5 “ANCHORAGE & RACK”) typically found in the building structural design drawings and geotechnicalreport. 3.IfANCHORAGEonlyisrequired,anyLowellseismic-certifiedrack(LSGR, LSERorLSER-Fseries)canbeused,providedthatit’sinstalledaccording totheinstructionsintheP.E.-Certifiedanchorageinstallationmanualincludedwitheachrack. 4.IfANCHORAGE&RACKqualification(perIBC)isrequired,LSGRorLSER rackswithadjustablerailsshallbespecified.(LSER-Frackshavefixedrails andarenotrecommendedforthisclassification.)Inaddition,IBCQualifier Braces may also be required for essential and non-essential facility installationswheretherackhasanImportanceFactor(Ip)of1.5,dependingontheseismicregion.TodetermineifanIBCQualifierBraceispartof thequalifyingpackage,refertotheSeismicTechnicalSummaryavailable online(LowellMfg.com),whereseismic-qualifiedracksareshownwiththeir associatedSpectralAcceleration(Ss)ratingsbasedoninstalledbuilding location(lower,middle,upperthird).IftherequiredSpectralAcceleration ishigherthanthatshownfortherackonly,selectarackwiththeappropriateIBCQualifierBrace(EQQextension)tomeettherequirements. Note: optional platform bases are not for use with seismic-rated racks. Seismic-certified racks use special, thin, knockout panels for anchoring clearance. Standard knockout panels do not fit. 1-pair 2-pair 4-pair Positioning for factory-installed IBC qualifier braces. IBC (anchorage only) • Site spectral acceleration (Ss) • Verify site soil class is A, B, C, or D • Importance Factor, Ip (1.0) IBC / CBC / OSHPD (anchorage AND cabinet essential facilities) • Site spectral acceleration (Ss) • Verify site soil class is A, B, C, or D • Importance Factor, Ip (1.5) • Location in building (1/3h, 2/3h, roof & below) 13 Seismic-Certified Enclosed Racks LSER-series: RACK: ForANCHORAGEorANCHORAGE&RACKqualification.Essential FacilityinstallationsmayrequiretheIBCQualifierBraceoption. LowellSeismic-certifiedEnclosedRacksfeatureadjustablerails, permanent(fixed)sidesandareardoor—allventedtopandbottom. Optionalfrontdoorcanbeorderedseparately.Featuresall-welded constructionfrom100%certifiedU.S.steel.UL-Listedforloadsup to3150lbs(1429kg);seismicallyqualifiedupto1200lbs.,dependent upon model. Beveled edges on four corners. Mar-resistant, blackwrinklepowderepoxyfinish.Features:  Width: overallwidth:23.06" (586mm).rail-mountingwidth:19" EIA(483mm). Top Closure Panels: (2)16-gaugesteelpanels(either3U& 4Uor3U&7U,dependingonrackdepth)createaflushclosure fortopofrack.Panelsaremountedtofrontofrackduringshippingtoprovideadditionalstability.Topclosurepanelscanbe replacedwith(optional)fanpanelsforactivethermalmanagement. Two 16-ga. steel closure panels fit together to provide flush closure for top of rack. Closure panels are included as standard equipment. Side rail supports allow mounting rails to be repositioned anywhere, front-to-back. Recessed Rear Door: ventedtopandbottomforpassive heatdissipation.Lockandkey. Adjustable mounting rails can be repositioned anywhere along side rail supports. Mounting rails can be fieldreversed to access square-punched holes for alternate hardware needs. Adjustable Mounting Rails: canbeadjustedtomountanywhere(front-to-back)alongsiderailsupports.Printedscaleon railsfacilitatesequipmentinstallationwhilethedual-serieshole patternsupportsmultiplehardwarepreferences.Thepre-set 10-32tapped-holeoptioncanbefield-reversedtousesquare holesfor12-24,10-32or6mmscrewswithcagenuts.Twopair of mounting rails are included with 32" depth racks; shallowerracksinclude1-pairofrails. Side Rail Supports: provideaplatformformountingrailsto berepositionedanywhere,front-to-back. Cable Management Features: Top:6" deeprearknockout plane;0.5" knockoutsalongsidesforBNCwirelessantennae. Bottom:opendesignincludesgroundinglugforcableaccess. Rear: knockout panels located above and below rear door featuremultipleloomingoptions. Removable “thin” knockout panels above and below rear door. Reinforced base with corner weldments feature holes for anchors (not included). 22 in.D models = 20.125 in. 27 in.D models = 25.125 in. 32 in.D models = 30.125 in. 36 in.D models = 34.125 in. Front Door (LFD-series): surface,steeldoorextends1" (25.4mm) fromframeandincludeslockandkey.Mountsleftorrightwithout drilling,fieldchangeable.180˚swing.Fourbevelededges.Black wrinklepowderepoxyfinish. Solid: singlepiececonstructionforstrengthanddurability. Plexiglas: steelframewithsmokedPlexiglasinsert. Fully-vented: allowspassiveheatdistribution. Dual-door: seeRackOptionsfordual-doorframe. Rear OPTIONS: Front Hardware: PilotPoint™screwswithcaptivewashers(25-50). Additional Mounting Rails (RRD-series): rackrailswithdualholepattern(tapped10-32on1side,square-punched12-24,1032,and6mmonalternateside)formiddle-depthorrearofrack. Soldinpairs.Includesmountinghardware. Open Back (-LRD suffix): rackcanbeorderedwithoutarear door,usethe“LRD”suffixinthemodelnumber. IBC Qualifier Brace (-EQQ suffix): must be factory installed. Availablein1,2or4pair. RACKWARE:® AccessoriesarelistedunderRackware® Accessories,ThermalManagementandCableManagement. 1-pair 2-pair 4-pair Some applications require the IBC Qualifier Brace option. Braces must be factory-installed. 14 Model No. Description Rack Units Overall D in. (mm) Former No. Carton Pack RACKS LSER-2122* LSER-2422* LSER-3522* LSER-4022* LSER-4422* LSER-2127* LSER-2427* LSER-3527* LSER-4027* LSER-4427* LSER-3532 LSER-4032 LSER-4432 Seismic-certified Enclosed Rack Seismic-certified Enclosed Rack Seismic-certified Enclosed Rack Seismic-certified Enclosed Rack Seismic-certified Enclosed Rack Seismic-certified Enclosed Rack Seismic-certified Enclosed Rack Seismic-certified Enclosed Rack Seismic-certified Enclosed Rack Seismic-certified Enclosed Rack Seismic-certified Enclosed Rack Seismic-certified Enclosed Rack Seismic-certified Enclosed Rack 21 24 35 40 44 21 24 35 40 44 35 40 44 22 (559) 22 (559) 22 (559) 22 (559) 22 (559) 27 (686) 27 (686) 27 (686) 27 (686) 27 (686) 32 (813) 32 (813) 32 (813) L265-36-S L265-42-S L265-61-S L265-70-S L265-77-S L267-36-S L267-42-S L267-61-S L267-70-S L267-77-S L268-61-S L268-70-S L268-77-S 1 1 1 1 1 1 1 1 1 1 1 1 1 121 (55) 122 (55) 160 (73) 180 (82) 221 (100) 124 (56) 147 (67) 173 (78) 194 (88) 210 (95) 220 (100) 225 (102) 250 (113) 21 24 35 40 44 21 24 35 40 44 35 40 44 22 (559) 22 (559) 22 (559) 22 (559) 22 (559) 27 (686) 27 (686) 27 (686) 27 (686) 27 (686) 32 (813) 32 (813) 32 (813) 1 1 1 1 1 1 1 1 1 1 1 1 1 121 (55) 122 (55) 160 (73) 180 (82) 221 (100) 124 (56) 147 (67) 173 (78) 194 (88) 210 (95) 220 (100) 225 (102) 250 (113) RACKS LESS REAR DOOR Seismic-certified Enclosed Rack Less Rear Door LSER-2122-LRD* LSER-2422-LRD* Seismic-certified Enclosed Rack Less Rear Door LSER-3522-LRD* Seismic-certified Enclosed Rack Less Rear Door LSER-4022-LRD* Seismic-certified Enclosed Rack Less Rear Door LSER-4422-LRD* Seismic-certified Enclosed Rack Less Rear Door LSER-2127-LRD* Seismic-certified Enclosed Rack Less Rear Door LSER-2427-LRD* Seismic-certified Enclosed Rack Less Rear Door LSER-3527-LRD* Seismic-certified Enclosed Rack Less Rear Door LSER-4027-LRD* Seismic-certified Enclosed Rack Less Rear Door LSER-4427-LRD* Seismic-certified Enclosed Rack Less Rear Door LSER-3532-LRD Seismic-certified Enclosed Rack Less Rear Door LSER-4032-LRD Seismic-certified Enclosed Rack Less Rear Door LSER-4432-LRD Seismic-certified Enclosed Rack Less Rear Door OPTIONS RRD-24 RRD-35 RRD-40 RRD-44 LFD-21 LFD-24 LFD-35 LFD-40 LFD-44 LFD-21P LFD-24P LFD-35P LFD-40P LFD-44P LFD-21FV LFD-24FV LFD-35FV LFD-40FV LFD-44FV Rack Rails Dual-hole pattern (for 24U rack) Rack Rails Dual-hole pattern (for 35U rack) Rack Rails Dual-hole pattern (for 40U rack) Rack Rails Dual-hole pattern (for 44U rack) Solid Front Door (for 21U rack) Solid Front Door (for 24U rack) Solid Front Door (for 35U rack) Solid Front Door (for 40U rack) Solid Front Door (for 44U rack) Plexiglas Front Door (for 21U rack) Plexiglas Front Door (for 24U rack) Plexiglas Front Door (for 35U rack) Plexiglas Front Door (for 40U rack) Plexiglas Front Door (for 44U rack) Fully-Vented Front Door (for 21U rack) Fully-Vented Front Door (for 24U rack) Fully-Vented Front Door (for 35U rack) Fully-Vented Front Door (for 40U rack) Fully-Vented Front Door (for 44U rack) Carton Wt. lb. (kg) L212-42 1-pr L212-61 1-pr L212-70 1-pr L212-77 1-pr L2150-36 1 L2150-42 1 L2150-61 1 L2150-70 1 L2150-77 1 L2150-36P 1 L2150-42P 1 L2150-61P 1 L2150-70P 1 L2150-77P 1 L2150-36PF 1 L2150-42PF 1 L2150-61PF 1 L2150-70PF 1 L2150-77PF 1 14 (6) 15 (7) 17 (8) 20 (9) 19 (9) 23 (10) 32 (15) 36 (16) 44 (19) 17 (8) 21 (10) 26 (12) 28 (13) 32 (15) 16 (7) 20 (9) 25 (11) 26 (12) 30 (14) IBC QUALIFIER BRACE OPTION: the IBC Qualifier Brace must be factory-installed. To order a rack with this option, add the EQQ extension below to the rack model number above (ex. LSER-3522-EQQ1 or LSER-3522-LRD-EQQ4). EQQ1* EQQ2* EQQ4* IBC-Qualifier Brace (1 front, 1 rear) IBC-Qualifier Brace (2 front, 2 rear) IBC-Qualifier Brace (4 front, 4 rear) 1 2 4 (installed) (installed) (installed) *Note: If the IBC Qualifier Brace option is specified for a rack that normally includes only 1-pair of mounting rails, the factory will automatically install a second pair of mounting rails in the rear of the rack to support the brace and add a charge for the second set of rails (RRD-series). In this case, DO NOT order additional mounting rails unless a third set is desired. Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 15 LSER-F series: RACK: ForANCHORAGEonlyqualification. LowellSeismic-certifiedEnclosedRackswithFixed-railsprovidean economicaloptionforapplicationsthatwon’trequirefrontmounting rails to be repositioned and are classified as non-essential, ImportanceFactorof1.0.Fixedrailracksareseismicallyqualified forloadsupto1500lbs.Racksincludesidesandareardoor—all vented top and bottom. Optional front door can be ordered separately.Featuresall-weldedconstructionfrom100%certified U.S. steel. Beveled edges on four corners. Mar-resistant, black wrinklepowderepoxyfinish.Features: Width: overallwidth:23.06" (586mm);rail-mountingwidth:19" EIA(483mm).  Top Closure Panels: (2)16-gaugesteelpanels(either3U& 4Uor3U&7U,dependingonrackdepth)createaflushclosure for top of rack. Panels are mounted to front of rack during shippingtoprovideadditionalstability.Topclosurepanelscan be replaced with (optional) fan panels for active thermal management. Recessed Rear Door: ventedtopandbottomforpassive heatdissipation.Lockandkey. Two 16-ga. steel closure panels fit together to provide flush closure for top of rack. Closure panels are included as standard equipment. Fixed mounting rails stay positioned in front of rack. They can be field-reversed to access squarepunched holes for alternate hardware needs. Fixed Mounting Rails: aremountedinafixed-positionatfront ofrack.Railsfeatureaprintedscaletofacilitateequipment installation.Dual-holepatternfeatures10-32tappedholesthat canbefield-reversedtosupportcagenutsmountedinsquare holesusing12-24,10-32or6mmscrews. Rear Mount Capability: racks will accept rear rails (RRDseries)mountedinafixedpositionatrearofrack,aswellas powerorwiremanagementaccessories.Orderseparately. Cable Management Features: Top:6" deeprearknockout plane;0.5" knockoutsalongsidesforBNCwirelessantennae. Bottom:opendesignincludesgroundinglugforcableaccess. Rear: knockout panels located above and below rear door featuremultipleloomingoptions. Removable “thin” knockout panels above and below rear door. Additional Mounting Rails (RRD-series): mounting rails with dual-holepattern(tapped10-32on1side,square-punched12-24, 10-32, and 6mm on alternate side) can be mounted in rear of LSER-Fseriesracks.Soldinpairs.Includesmountinghardware. Open Back (-LRD suffix): rackcanbeorderedwithoutareardoor, selectthe“LRD”suffixinthemodelnumber. RACKWARE:® 22 in.D models = 20.125 in. 27 in.D models = 25.125 in. 32 in.D models = 30.125 in. 36 in.D models = 34.125 in. Front Door (LFD-series): surface,steeldoorextends1" (25.4mm) fromframeandincludeslockandkey.Mountsleftorrightwithout drilling,fieldchangeable.180˚swing.Fourbevelededges.Black wrinklepowderepoxyfinish. Solid: singlepiececonstructionforstrengthanddurability. Plexiglas: steelframewithsmokedPlexiglasinsert. Fully-vented: allowspassiveheatdistribution. Dual-door: seeRackOptionssectionfordual-doorframe. Rear OPTIONS: Front Hardware: PilotPoint™screwswithcaptivewashers(25-50). Reinforced base with corner weldments feature holes for anchors (not included). RACKWARE® accessories (like fan panels for active heat dissipation) can be found in the accessories section. AccessoriesarelistedunderRackware® Accessories,ThermalManagementandCableManagement. Optional surface front door is available in solid steel, fully-vented steel, or steel frame with smoked Plexiglas insert. 16 Model No. RACKS LSER-F2122 LSER-F2422 LSER-F3522 LSER-F4022 LSER-F4422 LSER-F2127 LSER-F2427 LSER-F3527 LSER-F4027 LSER-F4427 Description Seismic-certified Enclosed Rack Fixed-rails Seismic-certified Enclosed Rack Fixed-rails Seismic-certified Enclosed Rack Fixed-rails Seismic-certified Enclosed Rack Fixed-rails Seismic-certified Enclosed Rack Fixed-rails Seismic-certified Enclosed Rack Fixed-rails Seismic-certified Enclosed Rack Fixed-rails Seismic-certified Enclosed Rack Fixed-rails Seismic-certified Enclosed Rack Fixed-rails Seismic-certified Enclosed Rack Fixed-rails RACKS LESS REAR DOOR LSER-F2122-LRD Seismic-certified Enclosed Rack Fixed-rails Less Rear Door LSER-F2422-LRD Seismic-certified Enclosed Rack Fixed-rails Less Rear Door LSER-F3522-LRD Seismic-certified Enclosed Rack Fixed-rails Less Rear Door LSER-F4022-LRD Seismic-certified Enclosed Rack Fixed-rails Less Rear Door LSER-F4422-LRD Seismic-certified Enclosed Rack Fixed-rails Less Rear Door LSER-F2127-LRD Seismic-certified Enclosed Rack Fixed-rails Less Rear Door LSER-F2427-LRD Seismic-certified Enclosed Rack Fixed-rails Less Rear Door LSER-F3527-LRD Seismic-certified Enclosed Rack Fixed-rails Less Rear Door LSER-F4027-LRD Seismic-certified Enclosed Rack Fixed-rails Less Rear Door LSER-F4427-LRD Seismic-certified Enclosed Rack Fixed-rails Less Rear Door OPTIONS LFD-21 Solid Front Door (for 21U rack) LFD-24 Solid Front Door (for 24U rack) LFD-35 Solid Front Door (for 35U rack) LFD-40 Solid Front Door (for 40U rack) LFD-44 Solid Front Door (for 44U rack) LFD-21P Plexiglas Front Door (for 21U rack) LFD-24P Plexiglas Front Door (for 24U rack) LFD-35P Plexiglas Front Door (for 35U rack) LFD-40P Plexiglas Front Door (for 40U rack) LFD-44P Plexiglas Front Door (for 44U rack) LFD-21FV Fully-Vented Front Door (for 21U rack) LFD-24FV Fully-Vented Front Door (for 24U rack) LFD-35FV Fully-Vented Front Door (for 35U rack) LFD-40FV Fully-Vented Front Door (for 40U rack) LFD-44FV Fully-Vented Front Door (for 44U rack) RRD-21 Rack Rails Dual-hole pattern (for 21U rack) RRD-24 Rack Rails Dual-hole pattern (for 24U rack) RRD-35 Rack Rails Dual-hole pattern (for 35U rack) RRD-40 Rack Rails Dual-hole pattern (for 40U rack) RRD-44 Rack Rails Dual-hole pattern (for 44U rack) Rack Units Overall D in. (mm) 21 24 35 40 44 21 24 35 40 44 22 (559) 22 (559) 22 (559) 22 (559) 22 (559) 27 (686) 27 (686) 27 (686) 27 (686) 27 (686) 21 24 35 40 44 21 24 35 40 44 22 (559) 22 (559) 22 (559) 22 (559) 22 (559) 27 (686) 27 (686) 27 (686) 27 (686) 27 (686) Former No. L260-36-S L260-42-S L260-61-S L260-70-S L260-77-S L262-36-S L262-42-S L262-61-S L262-70-S L262-77-S Carton Carton Wt. Pack lb. (kg) 1 1 1 1 1 1 1 1 1 1 105 (48) 115 (52) 158 (72) 177 (80) 189 (86) 115 (52) 132 (60) 167 (76) 185 (84) 200 (91) 1 1 1 1 1 1 1 1 1 1 105 (48) 115 (52) 158 (72) 177 (80) 189 (86) 115 (52) 132 (60) 167 (76) 185 (84) 200 (91) L2150-36 1 L2150-42 1 L2150-61 1 L2150-70 1 L2150-77 1 L2150-36P 1 L2150-42P 1 L2150-61P 1 L2150-70P 1 L2150-77P 1 L2150-36PF 1 L2150-42PF 1 L2150-61PF 1 L2150-70PF 1 L2150-77PF 1 L212-36 1-pr L212-42 1-pr L212-61 1-pr L212-70 1-pr L212-77 1-pr Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 19 (9) 23 (10) 32 (15) 36 (16) 44 (19) 17 (8) 21 (10) 26 (12) 28 (13) 32 (15) 16 (7) 20 (9) 25 (11) 26 (12) 30 (14) 12 (5.5) 14 (6) 15 (7) 17 (8) 20 (9) 17 Seismic-Certified Ganging Racks LSGR series: RACK: ForANCHORAGEorANCHORAGE&RACKqualification.Essential FacilityinstallationsmayrequiretheIBCQualifierBraceoption. LowellSeismic-certifiedGangingRacksaredesignedtobelinked togetherformultiple-rackapplications.Theyfeatureopensidesto facilitateaccesstowireandcablebundlesandall-weldedconstructionforstrengthanddurability.Load-testedto3500lbs.(1588kg); seismicallyqualifiedupto1200lbs.dependentuponmodel.Racks includeplentiful,pre-drilledholesforwirelooming,bevelededges on4corners,andablackwrinklepowderepoxyfinish.Features: Width: overallwidth:23.06" (586mm);rail-mountingwidth:19" EIA(483mm). Top Closure Panels:two16-gaugesteelpanels(3U&4Uor 3U&7Udependingonrackdepth)createflushclosurefortop ofrack.Panelsaremountedtofrontofrackduringshippingto provideadditionalstability.Topclosurepanelscanbereplaced with(optional)fanpanelsforactivethermalmanagement(order separately). Two 16-ga. steel closure panels fit together to provide flush closure for top of rack. Panels are included as standard equipment. Recessed Rear Door: ventedtopandbottomforpassiveheat dissipation,locking. Adjustable mounting rails can be repositioned anywhere along side rail supports. Mounting rails can be field-reversed to access squarepunched holes for alternate hardware needs. Adjustable Mounting Rails: can be adjusted to mount anywhere(front-to-back)alongsiderailsupports.Printedscale oneachrailfacilitatesequipmentinstallationwhilethedualseriesholepatternsupportsmultiplehardwarepreferences. Thepre-set10-32tapped-holeoptioncanbefield-reversedto usesquareholesfor12-24,10-32or6mmscrewswithcage nuts.Shallow(22"D)modelsinclude1-pairofrails;otherdepths include2-pair. Side Rail Supports: provideaplatformformountingrailsto bepositionedanywhere,front-to-back. Cable Management Features: Top:6" deeprearknockout plane;0.5" knockoutsalongsidesforBNCwirelessantennae. Bottom:opendesignincludesgroundinglugforcableaccess. Rear:knockoutpanelslocatedaboveandbelowreardoorfeaturemultipleloomingoptions. Hardware: PilotPoint™screwswithcaptivewashers(25-50). 22 in.D models = 20.125 in. 27 in.D models = 25.125 in. 32 in.D models = 30.125 in. 36 in.D models = 34.125 in. Front Front Door (LFD-series): surface,steeldoorextends1" (25.4mm) fromframeandincludeslockandkey.Mountsleftorrightwithout drilling,fieldchangeable.180˚swing.Fourbevelededges.Black wrinklepowderepoxyfinish. Solid: singlepiececonstructionforstrengthanddurability. Plexiglas: steelframewithsmokedPlexiglasinsert. Fully-vented: allowspassiveheatdistribution. Dual-door Frame: seeRackOptions. Rear OPTIONS: Removable “thin” knockout panels above and below rear door. Reinforced base with corner weldments feature holes for anchors (not included). Additional Mounting Rails (RRD-series): mounting rails with dual-holepattern(tapped10-32on1side,square-punched12-24, 10-32,and6mmonalternateside).Soldinpairs.Includesmounting hardware. Side Panels (-SP suffix): 16-gaugesteel,ventedtopandbottom. Centergrips.Securewithscrews(provided).Blackwrinklepowder epoxyfinish. Some applications require the IBC Qualifier Brace option. Braces must be factory-installed. Open Back (-LRD suffix): rackcanalsobeorderedwithoutarear door—usethe“LRD”extensioninthemodelnumber. IBC Qualifier Brace (-EQQ suffix): must be factory installed. Availablein1,2or4pair. RACKWARE:® AccessoriesarelistedunderRackware® Accessories,ThermalManagementandCableManagement. 1-pair 18 2-pair 4-pair Model No. Description RACKS LSGR-3522* Seismic-certified Ganging Rack LSGR-4022* Seismic-certified Ganging Rack LSGR-4422* Seismic-certified Ganging Rack LSGR-2427 Seismic-certified Ganging Rack LSGR-3527 Seismic-certified Ganging Rack LSGR-4027 Seismic-certified Ganging Rack LSGR-4427 Seismic-certified Ganging Rack LSGR-3532 Seismic-certified Ganging Rack LSGR-4032 Seismic-certified Ganging Rack LSGR-4432 Seismic-certified Ganging Rack Seismic-certified Ganging Rack LSGR-4036 LSGR-4436 Seismic-certified Ganging Rack RACKS LESS REAR DOOR LSGR-3522-LRD* Seismic-certified Ganging Rack Less Rear Door LSGR-4022-LRD* Seismic-certified Ganging Rack Less Rear Door LSGR-4422-LRD* Seismic-certified Ganging Rack Less Rear Door LSGR-2427-LRD Seismic-certified Ganging Rack Less Rear Door LSGR-3527-LRD Seismic-certified Ganging Rack Less Rear Door LSGR-4027-LRD Seismic-certified Ganging Rack Less Rear Door LSGR-4427-LRD Seismic-certified Ganging Rack Less Rear Door LSGR-3532-LRD Seismic-certified Ganging Rack Less Rear Door LSGR-4032-LRD Seismic-certified Ganging Rack Less Rear Door LSGR-4432-LRD Seismic-certified Ganging Rack Less Rear Door LSGR-4036-LRD Seismic-certified Ganging Rack Less Rear Door LSGR-4436-LRD Seismic-certified Ganging Rack Less Rear Door OPTIONS LGR-3522-SP Side Panels (for LSGR-3522) LGR-3527-SP Side Panels (for LSGR-3527) LGR-3532-SP Side Panels (for LSGR-3532) LGR-4022-SP Side Panels (for LSGR-4022) LGR-4027-SP Side Panels (for LSGR-4027) LGR-4032-SP Side Panels (for LSGR-4032) LGR-4036-SP Side Panels (for LSGR-4036) LGR-4422-SP Side Panels (for LSGR-4422) LGR-4427-SP Side Panels (for LSGR-4427) LGR-4432-SP Side Panels (for LSGR-4432) LGR-4436-SP Side Panels (for LSGR-4436) LFD-21 Solid Front Door (for 21U rack) LFD-24 Solid Front Door (for 24U rack) LFD-35 Solid Front Door (for 35U rack) LFD-40 Solid Front Door (for 40U rack) LFD-44 Solid Front Door (for 44U rack) LFD-21P Plexiglas Front Door (for 21U rack) LFD-24P Plexiglas Front Door (for 24U rack) LFD-35P Plexiglas Front Door (for 35U rack) LFD-40P Plexiglas Front Door (for 40U rack) LFD-44P Plexiglas Front Door (for 44U rack) LFD-21FV Fully-Vented Front Door (for 21U rack) LFD-24FV Fully-Vented Front Door (for 24U rack) LFD-35FV Fully-Vented Front Door (for 35U rack) LFD-40FV Fully-Vented Front Door (for 40U rack) LFD-44FV Fully-Vented Front Door (for 44U rack) RRD-35 Mounting Rails Dual-hole pattern (for 35U rack) RRD-40 Mounting Rails Dual-hole pattern (for 40U rack) RRD-44 Mounting Rails Dual-hole pattern (for 44U rack) Rack Units Overall D in. (mm) Former No. Carton Pack Carton Wt. lb. (kg) 35 40 44 24 35 40 44 35 40 44 40 44 22 (559) 22 (559) 22 (559) 27 (686) 27 (686) 27 (686) 27 (686) 32 (813) 32 (813) 32 (813) 36 (914) 36 (914) L275-61-S L275-70-S L275-77-S L277-42-S L277-61-S L277-70-S L277-77-S L278-61-S L278-70-S L278-77-S L279-70-S L279-77-S 1 1 1 1 1 1 1 1 1 1 1 1 160 (73) 147 (67) 181 (82) 145 (66) 165 (75) 176 (80) 186 (84) 170 (77) 181 (82) 191 (87) 185 (84) 205 (93) 35 40 44 24 35 40 44 35 40 44 40 44 22 (559) 22 (559) 22 (559) 27 (686) 27 (686) 27 (686) 27 (686) 32 (813) 32 (813) 32 (813) 36 (914) 36 (914) 1 1 1 1 1 1 1 1 1 1 1 1 160 (73) 147 (67) 181 (82) 145 (66) 165 (75) 176 (80) 186 (84) 170 (77) 181 (82) 191 (87) 185 (84) 205 (93) 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1-pr 1-pr 1-pr 63 (29) 78 (35) 90 (41) 55 (25) 87 (39) 100 (45) 114 (52) 77 (35) 96 (43) 108 (49) 122 (55) 19 (9) 23 (10) 32 (15) 36 (16) 44 (19) 17 (8) 21 (10) 26 (12) 28 (13) 32 (15) 16 (7) 20 (9) 25 (11) 26 (12) 30 (14) 15 (7) 17 (8) 20 (9) L275-61SP L277-61SP L278-61SP L275-70SP L277-70SP L278-70SP L279-70SP L275-77SP L277-77SP L278-77SP L279-77SP L2150-36 L2150-42 L2150-61 L2150-70 L2150-77 L2150-36P L2150-42P L2150-61P L2150-70P L2150-77P L2150-36PF L2150-42PF L2150-61PF L2150-70PF L2150-77PF L212-61 L212-70 L212-77 IBC QUALIFIER BRACE OPTION: The IBC Qualifier Brace must be factory-installed. To order a rack with this option, add the EQQ extension below to the rack model number above (ex. LSGR-3522-EQQ1 or LSGR-3522-LRD-EQQ4). EQQ1* EQQ2* EQQ4* IBC-Qualifier Brace (1 front, 1 rear) IBC-Qualifier Brace (2 front, 2 rear) IBC-Qualifier Brace (4 front, 4 rear) 1 2 4 (installed) (installed) (installed) *Note: If the IBC Qualifier Brace option is specified for a rack that normally includes only 1-pair of mounting rails, the factory will automatically install a second pair of mounting rails in the rear of the rack to support the brace, and add a charge for the second set of rails (RRD-series listed above). In this case, DO NOT order additional mounting rails unless a third set is desired. Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 19 RACK III: VARI-RACK® Adjustable Depth LVR-series: RACK: OPTIONS: Lowell’sVari-Rack® hasathinframeandvariabledepththat’sselectedduringinstallation,makingitidealforbothfree-standingand built-inapplicationssuchasinsidecustomcabinetryorcredenzas, undercountersorbeneathdesks.Withaloadcapacityof400lbs., theVari-Rackisespeciallysuitedforsolidelectronicssupport.Two basicmodels(14"-21"Dand21"-28"D)inassortedheightsaccommodateawidevarietyofapplications.Forevengreaterflexibility,the cornerpostmountingrailscanbefield-cutforacustomfit(rails featureprintedcut-markstoassistaccuratecutting).Whensetto maximum-depth, exposed areas in top and base will accept (optional)fanpanels.Blackpowderepoxyfinish.Packagedand shippedunassembled(2cartons).Features: Width: overallwidth:19.21" (488mm);rail-mountingwidth: 19" EIA(483mm). Corner Post Mounting Rails: 2-pair(tapped10-32),11-ga. steel. Interchangeable rails feature a scale printed in both directionstoaidequipmentinstallation. Side Support Brackets: 1-pairincludedwithtallerracks(30U ortaller) Assembly Hardware: 5/16-18hexnuts,10-32x1/2flathead screws. Knockout Panel: forcablemanagement(toprear). Mounting Hardware: PilotPoint™screwswithcaptivewashers. Front Door (LVR-FD series): 1.38" (35mm)fromframe,includes lockandkey.Mountsleftorrightwithoutdrilling,fieldchangeable, 180˚swing.Blackwrinklepowderepoxyfinish. Solid: singlepiececonstructionforstrengthanddurability. Plexiglas: steelframewithsmokedPlexiglasinsert. Top knockout panel for cable management. Ships via Base features position for additional knockout panel (order separately). Taller models include side support brackets. Base and top feature pinning frame and scale with clearly marked inches, millimeters & rack unit increments. LVR-FD series. Front door includes lock & key set. Available in solid steel or steel with Plexiglas insert. Rear Access Cover (LVR-RAC series): ventedforpassiveheat dissipation.Lockandkeyset.Optionalfanpanelscanbemounted foractiveventilation(orderseparately). Side Panels (-SP suffix): extend1" beyondrackdepth(0.5" front, 0.5" rear). Black wrinkle finish. 22"D panels fit specified sizes in modelseries14"-21"Dor21"-28"D.26"Dsidepanelsfitspecified sizesinmodelseries21"-28"Donly. Additional Mounting Rails (LVR-RRT series): 1-pairof10-32 thin-flangemountingrails,adj.sidesupportbracketsandhardware. LVR-RAC series rear access cover. Protective Runner Kit (PRK): plasticglidesprovideprotectionfor woodsurfaceswhenLVR-seriesracksareinstalledinsidecabinets. Cable Chase (LVR44-series): 3" wideracewayforwireorcable management.TwooptionsfitLVR44Uracksetat21"Dor26"D. LVR-MB series base. Mobile Base (LVR-MB21 or LVR-MB26):** 14-ga.steelskirted designhides(4)3" swivel-casterswhileaddingstabilitytomobile unit.Increasesoverallrackheightby4.25".Availableforracksset to21"Dor26"D.Unassembled. LVR-C3S: caster set (2-pair swivel). Casters (LVR-C3S or LVR-C3SL):** provide mobility when mountedtorackbase.Availableinswivelorswivel/lockingsets. DISTRIBUTORS: Specialpackagedsetsforstocking: LVR-C3SL: caster set (1-pair swivel & 1-pair swivel-locking). Top & Base Set (–TB suffix): includes1topand1base(norails). CombinewithRackRailSetbelowtobuild1rack. Rack Rail Set (LVR-RRTC series): includes2-pairofcorner-post mountingrailsandrackassemblyhardware.CombinewithTop& BaseSetabovetobuild1rack. LVR-44-series. **Note: use caution when loading equipment or moving racks on a mobile base or casters to avoid tip-over. 20 PRK protective runner kit. Model No. Description Rack Units Overall D in. (mm) RACKS: LVR-8-1421 Vari-Rack 8 14-21 (356-533) LVR-14-1421 Vari-Rack 14 14-21 (356-533) LVR-22-1421 Vari-Rack 22 14-21 (356-533) LVR-30-1421 Vari-Rack 30 14-21 (356-533) LVR-38-1421 Vari-Rack 38 14-21 (356-533) Vari-Rack 44 14-21 (356-533) LVR-44-1421 LVR-8-2128 Vari-Rack 8 21-28 (533-711) LVR-14-2128 Vari-Rack 14 21-28 (533-711) LVR-22-2128 Vari-Rack 22 21-28 (533-711) LVR-30-2128 Vari-Rack 30 21-28 (533-711) LVR-38-2128 Vari-Rack 38 21-28 (533-711) LVR-44-2128 Vari-Rack 44 21-28 (533-711) OPTIONS: Former No. LVR-FD-8 Vari-Rack Front Door (solid, for LVR8-series) LVR-FD-14 Vari-Rack Front Door (solid, for LVR14-series) LVR-FD-22 Vari-Rack Front Door (solid, for LVR22-series) LVR-FD-30 Vari-Rack Front Door (solid, for LVR30-series) LVR-FD-38 Vari-Rack Front Door (solid, for LVR38-series) LVR-FD-44 Vari-Rack Front Door (solid, for LVR44-series) LVR-FD-8P Vari-Rack Front Door (Plexiglas, for LVR8-series) LVR-FD-14P Vari-Rack Front Door (Plexiglas, for LVR14-series) LVR-FD-22P Vari-Rack Front Door (Plexiglas, for LVR22-series) LVR-FD-30P Vari-Rack Front Door (Plexiglas, for LVR30-series) LVR-FD-38P Vari-Rack Front Door (Plexiglas, for LVR38-series) LVR-FD-44P Vari-Rack Front Door (Plexiglas, for LVR44-series) LVR-8-21SP Vari-Rack Side Panels (for LVR8-series set to 21”D) LVR-14-21SP Vari-Rack Side Panels (for LVR14-series set to 21”D) LVR-22-21SP Vari-Rack Side Panels (for LVR22-series set to 21”D) LVR-30-21SP Vari-Rack Side Panels (for LVR30-series set to 21”D) LVR-38-21SP Vari-Rack Side Panels (for LVR38-series set to 21”D) LVR-44-21SP Vari-Rack Side Panels (for LVR44-series set to 21”D) LVR-8-26SP Vari-Rack Side Panels (for LVR8-2128 set to 26.25”D) LVR-14-26SP Vari-Rack Side Panels (for LVR14-2128 set to 26.25”D) LVR-22-26SP Vari-Rack Side Panels (for LVR22-2128 set to 26.25”D) LVR-30-26SP Vari-Rack Side Panels (for LVR30-2128 set to 26.25”D) LVR-38-26SP Vari-Rack Side Panels (for LVR38-2128 set to 26.25”D) LVR-44-26SP Vari-Rack Side Panels (for LVR44-2128 set to 26.25”D) LVR-RAC8V Vari-Rack Rear Access Cover (for LVR8-series) LVR-RAC14V Vari-Rack Rear Access Cover (for LVR14-series) LVR-RAC22V Vari-Rack Rear Access Cover (for LVR22-series) LVR-RAC30V Vari-Rack Rear Access Cover (for LVR30-series) LVR-RAC38V Vari-Rack Rear Access Cover (for LVR38-series) LVR-RAC44V Vari-Rack Rear Access Cover (for LVR44-series) LVR-RRT10 Additional Rack Rails (for 10U rack) LVR-RRK10 LVR-RRT16 Additional Rack Rails (for 16U rack) LVR-RRK16 LVR-RRT24 Additional Rack Rails (for 24U rack) LVR-RRK24 LVR-RRT32 Additional Rack Rails (for 32U rack) LVR-RRK32 LVR-RRT40 Additional Rack Rails (for 40U rack) LVR-RRK40 LVR-MB21 Vari-Rack Mobile Base (for 21"D rack) LVR-MB26 Vari-Rack Mobile Base (for 26"D rack) LVR-C3S Vari-Rack Casters (3”) Swivel LVR-C3SL Vari-Rack Casters (3”) Swivel-Locking LVR44-21-CC3 Vari-Rack Cable Chase (for 21"D rack) LVR44-26-CC3 Vari-Rack Cable Chase (for 26"D rack) PRK Protective Runner Kit SPECIAL PACKAGING FOR DISTRIBUTOR STOCKING: LVR-1421TB Vari-Rack Top & Base Set 14-21"D (no rails) LVR-2128TB Vari-Rack Top & Base Set 21-28"D (no rails) LVR-RRTC8 Vari-Rack Rack Rail Set (thin-flange, corner post) with rack assembly hardware 8U LVR-RRTC14 Vari-Rack Rack Rail Set (thin-flange, corner post) with rack assembly hardware 14U LVR-RRTC22 Vari-Rack Rack Rail Set (thin-flange, corner post) with rack assembly hardware 22U LVR-RRTC30 Vari-Rack Rack Rail Set (thin-flange, corner post) with rack assembly hardware 30U LVR-RRTC38 Vari-Rack Rack Rail Set (thin-flange, corner post) with rack assembly hardware 38U LVR-RRTC44 Vari-Rack Rack Rail Set (thin-flange, corner post) with rack assembly hardware 44U Carton Pack Carton Wt. lb. (kg) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) 30 (14) 32 (15) 36 (16) 40 (18) 42 (19) 44 (20) 45 (20) 47 (21) 51 (23) 54 (24) 57 (26) 58 (26) 1 1 1 1 1 1 1 1 1 1 1 1 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1 1 1 1 1 1 1-pr 1-pr 1-pr 1-pr 1-pr 1 1 2-pr 2-pr 1 1 1 set 12 (5.5) 20 (9) 33 (15) 44 (20) 56 (25) 64 (29) 10 (4.5) 17 (8) 26 (12) 36 (16) 45 (20) 52 (24) 17 (8) 28 (13) 45 (20) 61 (28) 77 (35) 89 (40) 20 (9) 35 (16) 55 (25) 75 (34) 95 (43) 110 (50) 7 (3) 12 (5.5) 19 (9) 25 (11) 32 (15) 37 (17) 7 (3) 10 (4.5) 12 (5.5) 16 (7) 20 (9) 16 (7) 22 (10) 4 (2) 5 (2.5) 22 (10) 26 (12) 3 (1.5) 1 set 1 set 1 set 1 set 1 set 1 set 1 set 1 set 28 (13) 37 (17) 5 (2.5) 9 (4) 13 (6) 18 (8) 23 (10.5) 26 (12) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45 mm). 21 RACK IV: PORTABLE RACKS Transport Racks LPR-series: RACK: OPTIONS: LowellPortableRacksareideallysuitedforuseinschools,offices and similar locations that require mobile security for electronic equipment.Racksareclosedonallsides,topandbottomandfeature all-welded construction with cable lacing panels above and belowreardoor.Beveledcorneredges.Blackwrinklepowderepoxy finish.UL-Listed.Features: Width: overallwidth:23.06" (586mm);rail-mountingwidth:19" EIA(483mm). Front Door: 16-gauge steel door extends one inch from frame, includes lock and key. Mounts left or right without drilling, field changeable, 180˚ swing. Four beveled edges. Blackwrinklepowderepoxyfinish.Threestyles: Solid: singlepiececonstructionforstrengthanddurability. Plexiglas: steelframewithsmokedPlexiglasinsert. Fully-Vented: allowspassiveheatdistribution. Rear Door: recessed,vented,locking. Removable Knockout Panels: aboveandbelowreardoor. Heavy-duty 4" Casters: 1-pr.swiveland1-pr.swivel/locking. Mounting Rails: canbeadjustedtositanywhere(front-toback)alongsiderailsupports.Printedscaleonrailsfacilitates equipmentinstallation.Dual-seriesholepatternsupportsmultiplehardwarepreferences.Thepre-set10-32tapped-holeoption can be field-reversed to use 12-24, 10-32 or 6mm screw/cagenutsquare-holeoption.1-pair. Side Grip Handles: recessed,padded. Hardware: PilotPoint™screwswithcaptivewashers. LPR-series rack shown with solid front door that has been fieldreversed to left-hinge swing. Adjustable mounting rails can be repositioned anywhere along side rail supports. Rails can be field-reversed to access square-punched holes for alternate hardware needs. Relocatable knockout panels above & below rear door. Graphite Grey Laminate Top (LGT-series): foraboardroomqualityfinish,1" height.Laminate-coveredparticleboardwithrubber edgemolding.Roundedcorners.Extends0.81" (21mm)oneach side,1.09" (28mm)infrontandrear. Mounting Rails (RRD-series): additional set of mounting rails tosupportbackofequipment. Optional boardroomquality laminated top adds a finished look. Graphite Grey close-up. 22 Model No. Description RACKS LPR-1422 LPR-2122 LPR-2127 LPR-2427 LPR-1422FV LPR-2122FV LPR-2127FV LPR-2427FV LPR-1422P LPR-2122P LPR-2127P LPR-2427P Portable Rack with solid door Portable Rack with solid door Portable Rack with solid door Portable Rack with solid door Portable Rack with fully-vented door Portable Rack with fully-vented door Portable Rack with fully-vented door Portable Rack with fully-vented door Portable Rack with Plexiglas door Portable Rack with Plexiglas door Portable Rack with Plexiglas door Portable Rack with Plexiglas door OPTIONS LGT-22 LGT-27 RRD-14 RRD-21 RRD-24 Graphite Grey Top (for 22”D rack) Graphite Grey Top (for 27”D rack) Rack Rails Dual-hole (for 14U rack) Rack Rails Dual-hole (for 21U rack) Rack Rails Dual-hole (for 24U rack) Rack Units Overall D in. (mm) 14 21 21 24 14 21 21 24 14 21 21 24 22 (559) 22 (559) 27 (686) 27 (686) 22 (559) 22 (559) 27 (686) 27 (686) 22 (559) 22 (559) 27 (686) 27 (686) 14 21 24 Former No. L258-24 L258-36 L259-36 L259-42 L258-24PF L258-36PF L259-36PF L259-42PF L258-24P L258-36P L259-36P L259-42P GT-222 GT-227 L212-24 L212-36 L212-42 Overall H in. (mm) Usable D in. (mm) Carton Pack Carton Wt. lb. (kg) 36 (914) 48 (1219) 48 (1219) 53 (1346) 36 (914) 48 (1219) 48 (1219) 53 (1346) 36 (914) 48 (1219) 48 (1219) 53 (1346) 19 (483) 19 (483) 24 (610) 24 (610) 19 (483) 19 (483) 24 (610) 24 (610) 19 (483) 19 (483) 24 (610) 24 (610) 1 1 1 1 1 1 1 1 1 1 1 1 120 (54) 137 (62) 152 (69) 167 (76) 109 (49) 124 (56) 149 (68) 162 (73) 115 (52) 126 (57) 152 (69) 165 (75) 1 1 1-pr 1-pr 1-pr 21 (10) 25 (11) 10 (5) 12 (5) 14 (6) Presentation Rack LPPR-2432: preconfigured RACK: Lowell’sPortablePresentationRackispreconfiguredasaready-touse,boardroom-qualitysystem.The32" (813mm)depthaccommodatesanassortmentofelectronics.Rackisclosedonallsides,top andbottom,andincludesaGraphiteGreylaminatetop.Cablelacing panels above and below rear door. All-welded construction. 100% U.S. steel. Beveled corner edges. Black wrinkle powder epoxyfinish.UL-Listed.Features: Width: overall width including top: 24.69" (627mm); railmountingwidth:19" EIA(483mm). Plexiglas Front Door: with16-ga.steelframewithsmoked Plexiglasinsertextends1" fromrack,includeslockandkey. Mounts left or right without drilling, field changeable. 180˚ swing.Fourbevelededges. Graphite Grey Laminate Top: 1" height.Laminate-covered particle board with rubber edge molding. Rounded corners. Extends0.81" (21mm)oneachside,1.09" (28mm)frontandrear. Rear Door: recessed,vented,locking. Removable Knockout Panels: aboveandbelowreardoor. Mobile Base: skirtedbasehidescasters.2-pairof3" (76mm) swivelcasters,350lb.loadcapacityeach. Adjustable Mounting Rails: canbeadjustedtositanywhere (front-to-back)alongside-railsupports.Printedscalefacilitates equipment installation. Dual-series hole pattern supports multiplehardwarepreferences.Thepre-set10-32tapped-hole option can be field-reversed to use 12-24, 10-32 or 6mm screw/cagenutsquare-holeoption.2-pair. Hardware: PilotPoint™screwswithcaptivewashers. Casters: 3"casters(2-pair) Model No. Description LPPR-2432 Portable Presentation Rack The LPPR-2432 is preconfigured as a boardroom-quality presentation system. Rack Units Overall D in. (mm) Former No. Overall H in. (mm) Usable D in. (mm) Carton Pack Carton Wt. lb. (kg) 24 34 (864) LPR-42 50 (1270) 29 (737) 1 211 (96) Studio Racks LPSR-F series: sloped front RACK: OPTIONS: Lowell’sPortableSloped-frontRackwithFixed-railshasa15˚sloped frontforeasyvisibilityofcontentsfromaseatedposition.Rollout designisidealforunder-counteruseinstudioapplications.Available withorwithoutafrontdoor.All-weldedconstructionwithbeveled corners.FrontcutoutsabovefrontdooracceptDecoraswitchesto allow external access (order switches separately). Black wrinkle powderepoxyfinish.Features: Width: overallwidth:22.19" (564mm);rail-mountingwidth: 19" EIA(483mm) Usable Depth: varieswithslope(seespecsheet). Front Door: locking, stowaway design opens from top and slidesintobaseforstorage. Short Rear Door: recessed,locking.Leaves1Uopeningat baseforcableaccess. Casters: 4 twin-wheel casters for use on carpets and standardfloors.125lbs.loadcapacityeach. Fixed Mounting Rails: 1-pair. Hardware: PilotPoint™screwswithcaptivewashers. Front door stows away in base. Two front cutouts provide external access to Decorastyle switches (switches not included). Graphite Grey Laminate Top (LGT-LPSR): Laminate-covered particle board (1"H) with black rubber edge molding. Rounded corners.Extends0.81" (21mm)oneachside,1.09" (28mm)front andrear.TopWidth:23.75" (603mm) Model No. Description Rack Units LPSR-F1226 LPSR-F1226-LFD Portable Sloped-front Rack Rack Less Front Door 12 12 OPTIONS LGT-LPSR Graphite Top Overall D in. (mm) 26.5 (673) 26.5 (673) 20 (508) Ships via Former No. L45-21 L45-21LD L45-GT Overall H in. (mm) Carton Pack Carton Wt. lb. (kg) 27 (686) 27 (686) 1 1 79 (36) 75 (34) 1 (25) 1 17 (8) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45 mm). Overall height dimensions include casters, if any. 23 RACK V: WALL-MOUNT RACKS & SHELVES Pivoting Wall Racks LWBR-series: RACK: OPTIONS: 24 Lowell’s Wall-mount with Base Rack combines solid support with swing-outaccesstocables,wiresandequipment.Rackpivots90˚on stainlesssteelballtransfersforsmoothweighttransition.Fully-welded steelassemblyincludesprovisionsformultipleloominglocationsand distributedpowersupply.Keyoperatedsidelock.Loadcapacity:500 lbs.Steeltopwithfourknockouts(0.5"/13mm)accommodatestwo pairofdual-diversitywirelessantennae.Spring-loadmountingsystem allowsfront-to-backassemblywithouttools.Swingorientationisfieldchangeable.Ventedsidepanelsforpassiveheatdissipation.Additional 4Uofrackspaceinbase.Onerackshipsin3boxes.Features: Width: overallwidth:23" (586mm);rail-mountingwidth:19" EIA(483mm). Rear Opening: 12.5" x10" (318mmx254mm) Adjustable Mounting Rails: cansitanywhere(front-to-back) alongsidesupportrails.Printedscaleonrailsfacilitatesequipmentinstallation.Dual-seriesholepatternsupportsmultiple hardwarepreferences.Thepre-set10-32tapped-holeoption canbefield-reversedtouse12-24,10-32or6mmscrew/cage nutsquare-holeoption. 1-pair. Hardware: PilotPoint™10-32screwswithwashers. Front Door (LFD-series): surfacesteeldoorextends1" fromframe andincludeslockandkey.Mountsleftorrightwithoutdrilling,field changeable. 180˚ swing. Beveled edges, black wrinkle powder epoxyfinish. Solid: singlepiececonstructionforstrengthanddurability. Plexiglas: steelframewithsmokedPlexiglasinsert. Fully-vented: allowspassiveheatdistribution. Adjustable mounting rails can be repositioned anywhere along side rail supports and field-reversed to access squarepunched holes for alternate hardware needs. Stainless steel ball transfers provide smooth weight transition. Optional: surface front door in solid steel, fully-vented steel, or steel frame with smoked Plexiglas® insert. Model No. Description Rack Units Overall D in. (mm) Overall H in. (mm) Carton Pack Carton Wt. lb. (kg) RACKS LWBR-4022 LWBR-2428 LWBR-3528 LWBR-4028 LWBR-4428 LWBR-2432 LWBR-3532 LWBR-4032 Wall-Mount with Base Rack Wall-Mount with Base Rack Wall-Mount with Base Rack Wall-Mount with Base Rack Wall-Mount with Base Rack Wall-Mount with Base Rack Wall-Mount with Base Rack Wall-Mount with Base Rack 40 24 35 40 44 24 35 40 22 (569) 28 (721) 28 (721) 28 (721) 28 (721) 32 (823) 32 (823) 32 (823) 86 (2179) 58 (1467) 77 (1957) 86 (2179) 93 (2357) 58 (1467) 77 (1957) 86 (2179) 3 boxes 3 boxes 3 boxes 3 boxes 3 boxes 3 boxes 3 boxes 3 boxes 143 (65) 173 (78) 177 (80) 181 (82) 184 (83) 157 (71) 174 (79) 188 (85) OPTIONS LFD-21 LFD-24 LFD-35 LFD-40 LFD-44 LFD-21P LFD-24P LFD-35P LFD-40P LFD-44P LFD-21FV LFD-24FV LFD-35FV LFD-40FV LFD-44FV Solid Front Door (for 21U rack) Solid Front Door (for 24U rack) Solid Front Door (for 35U rack) Solid Front Door (for 40U rack) Solid Front Door (for 44U rack) Plexiglas Front Door (for 21U rack) Plexiglas Front Door (for 24U rack) Plexiglas Front Door (for 35U rack) Plexiglas Front Door (for 40U rack) Plexiglas Front Door (for 44U rack) Fully-vented Front Door (for 21U rack) Fully-vented Front Door (for 24U rack) Fully-vented Front Door (for 35U rack) Fully-vented Front Door (for 40U rack) Fully-vented Front Door (for 44U rack) 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 19 (9) 23 (10) 32 (15) 36 (16) 38 (17) 17 (8) 21 (10) 26 (12) 28 (13) 32 (15) 16 (7) 20 (9) 24 (11) 26 (12) 30 (14) Swing-out Wall Racks LWR-series: RACK: Lowell’sWall-mountRackisatwo-part,sectionalrackwithblack wrinklepowderepoxyfinish.Backboxandmountingsectionare packagedseparately. Backbox: 4.7" (119mm) deep with 10" square (254mm) opening,removableknockoutpanels(forconduitandwireless), lacing points, and provisions to attach board-mounted accessories.Twokeyedsidelocks. Mounting Section: 14" or18" (356or457mm)deep,1-pair ofadjustablerailswithprintedrackunitscale,integralrailstop and bottom, 4 knockouts (0.5"/13mm) for wireless, vented sides,andpanelhardware. Width: overallwidth:23.06" (586mm);rail-mountingwidth: 19" EIA(483mm). OPTIONS: Front Door (LFD-series): 20" wide surface steel door extends 1" fromframe,includeslockandkey.Mountsleftorrightwithoutdrilling, fieldchangeable,180˚swing.Blackwrinklepowderepoxyfinish. Solid: singlepiececonstructionforstrengthanddurability. Plexiglas: steelframewithsmokedPlexiglasinsert. Fully-vented: allowspassiveheatdistribution. Smaller LWR racks (14”D up to 21U and 18”D up to 12U) ship via UPS. Additional Mounting Rails (RRD-series): providerearsupport forrack-mountedequipment.RailsarelistedunderRackOptions. Model No. RACKS LWR-719 LWR-1019 LWR-1219 LWR-1619 LWR-2119 LWR-2419 LWR-3519 LWR-723 LWR-1023 LWR-1223 LWR-1623 LWR-2123 LWR-2423 LWR-3523 OPTIONS LFD-7 LFD-10 LFD-12 LFD-16 LFD-21 LFD-24 LFD-35 LFD-7P LFD-10P LFD-12P LFD-16P LFD-21P LFD-24P LFD-35P LFD-7FV LFD-10FV LFD-12FV LFD-16FV LFD-21FV LFD-24FV LFD-35FV Description Rack Units Overall D in. (mm) Former No. Overall H in. (mm) Usable D in. (mm) Carton Wt. FR lb. (kg) Carton Wt.BB lb. (kg) Wall-Mount Rack (sectional) Wall-Mount Rack (sectional) Wall-Mount Rack (sectional) Wall-Mount Rack (sectional) Wall-Mount Rack (sectional) Wall-Mount Rack (sectional) Wall-Mount Rack (sectional) Wall-Mount Rack (sectional) Wall-Mount Rack (sectional) Wall-Mount Rack (sectional) Wall-Mount Rack (sectional) Wall-Mount Rack (sectional) Wall-Mount Rack (sectional) Wall-Mount Rack (sectional) 7 10 12 16 21 24 35 7 10 12 16 21 24 35 19 (489) 19 (489) 19 (489) 19 (489) 19 (489) 19 (489) 19 (489) 23 (584) 23 (584) 23 (584) 23 (584) 23 (584) 23 (584) 23 (584) L250-12LD L250-17LD L250-21LD L250-28LD L250-36LD L250-42LD L250-61LD L253-12LD L253-17LD L253-21LD L253-28LD L253-36LD L253-42LD L253-61LD 18 (457) 24 (610) 27 (686) 34 (864) 43 (1092) 48 (1219) 67 (1702) 18 (457) 24 (610) 27 (686) 34 (864) 43 (1092) 48 (1219) 67 (1702) 16 (406) 16 (406) 16 (406) 16 (406) 16 (406) 16 (406) 16 (406) 20 (508) 20 (508) 20 (508) 20 (508) 20 (508) 20 (508) 20 (508) 52 (24) 54 (24) 60 (27) 68 (31) 81 (37) 89 (40) 109 (49) 57 (26) 63 (29) 70 (32) 81 (37) 91 (41) 98 (44) 127 (58) 24 (11) 27 (12) 29 (13) 35 (16) 43 (20) 46 (21) 60 (27) 24 (11) 27 (12) 29 (13) 35 (16) 43 (20) 46 (21) 60 (27) Carton Pack Carton Wt. Solid Front Door (for 7U rack) Solid Front Door (for 10U rack) Solid Front Door (for 12U rack) Solid Front Door (for 16U rack) Solid Front Door (for 21U rack) Solid Front Door (for 24U rack) Solid Front Door (for 35U rack) Plexiglas Front Door (for 7U rack) Plexiglas Front Door (for 10U rack) Plexiglas Front Door (for 12U rack) Plexiglas Front Door (for 16U rack) Plexiglas Front Door (for 21U rack) Plexiglas Front Door (for 24U rack) Plexiglas Front Door (for 35U rack) Fully-vented Front Door (for 7U rack) Fully-vented Front Door (for 10U rack) Fully-vented Front Door (for 12U rack) Fully-vented Front Door (for 16U rack) Fully-vented Front Door (for 21U rack) Fully-vented Front Door (for 24U rack) Fully-vented Front Door (for 35U rack) L2150-12 L2150-17 L2150-21 L2150-28 L2150-36 L2150-42 L2150-61 L2150-12P L2150-17P L2150-21P L2150-28P L2150-36P L2150-42P L2150-61P L2150-12PV L2150-17PV L2150-21PV L2150-28PV L2150-36PV L2150-42PV L2150-61PV 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45 mm). 12 (5) 12 (5) 14 (6) 16 (7) 19 (9) 23 (10) 32 (15) 11 (5) 12 (5) 13 (6) 15 (7) 17 (8) 21 (10) 26 (12) 10 (5) 11 (5) 12 (5) 13 (6) 16 (7) 20 (9) 25 (12) 25 Stationary Wall Racks LWR-F series: RACK: Lowell’snewWall-mountRackwithFixed-railsisacontemporary, economicalwallrackthathouses19" wideelectronicsinsmallsysteminstallations(schools,offices,etc.).Thewelded16-ga.steel rackwithbeveledfrontcornersincludes1-pairoffixedmounting rails,ventedsidesandseparatewallbracketwithmountingslots andknockouts.Durable,blackwrinklepowderepoxyfinish.Overall width:22.45",rail-mountingwidth:19" EIA(483mm).Loadcapacity for7Uand10Umodels:150lbs.,for4Umodels:100lbs. OPTIONS: Additional Rack Rails (LWR-F-RRT-series): thin-flange,mountingrailsprovideadditionalsupportforrackmountedequipment. Railsmounttobackofrack.Includesmountinghardware.Soldin pairs.Maybeusedwithrailconversionbracket. Front Door (LFD-series): frontdoorcanbeaddedto7Uor10U models.SeeLFD-seriesunderRackOptions. LWR-F racks feature a sturdy wall-mount bracket. Rail Conversion Bracket (RRTMB-F): add bracket to allow adjustablemountingrailsformiddle-depthuse.Includeshardware. Ships via Model No. Description Rack Units Overall H in. (mm) Overall D in. (mm) Usable D in. (mm) Carton Pack Carton Wt. lb. (kg) LWR-F-418 LWR-F-718 LWR-F-1018 OPTIONS LWR-F-RRT4 LWR-F-RRT7 LWR-F-RRT10 RRTMB-F Wall-mount Rack (fixed rails) Wall-mount Rack (fixed rails) Wall-mount Rack (fixed rails) 4 7 10 9 (229) 14 (356) 19 (483) 18 (457) 18 (457) 18 (457) 17 (432) 17 (432) 17 (432) 1 1 1 33 (15) 42 (19) 51 (23) Additional Rack Rails (for LWR-F-series) Additional Rack Rails (for LWR-F-series) Additional Rack Rails(for LWR-F-series) Rail Conversion Bracket 4 7 (178) 7 12.25 (311) 10 17.5 (444) 1-pr 1-pr 1-pr 1-kit 2 (1) 3 (1.5) 3 (1.5) 6 (3) Wall-mount Shelves WS21-17: SHELF: TheWallShelfisaheavy-duty,16-gaugesteelweldedshelfthat includesrearkeyholeslotsand0.75" (19mm)conduitknockoutson top,bottomandsides.Mar-resistant,blackpowderepoxyfinish. Features: Keyhole slots simplify mounting. Width: overallwidth:21" (537mm);rail-mountingwidth:19" EIA(483mm). Ships via Load capacity: 200lbs.(91kg),whenproperlyinstalled. Model No. Description Overall D in. (mm) Former No. Overall H in. (mm) Usable D in. (mm) Carton Pack Carton Wt. lb. (kg) WS21-17 Wall Shelf 17 (432) L14-21 15 (381) 14 (356) 1 21 (10) FS-series: SHELF: The flat-ship shelf is ready-to-install as it simply folds out (noassemblyrequired).Formedsteelconstructionwithoutwelds allowsshelftobemountedineitherdirection.Mountson16" stud centers.Includescenteropeningforwireaccessorplacementover outletsorfixtures,andpre-punchedcablelacing/accessorymountingholes.Features: FS-series shelves are designed to be installed in either direction. Overall Width: 18" (463mm). Load capacity: 100lbs.(45kg). Ships via 26 Model No. Description Overall D in. (mm) Overall H in. (mm) Carton Pack Carton Wt. lb. (kg) FS18-14 FS18-16 FS18-20 Flat-ship Shelf Flat-ship Shelf Flat-ship Shelf 14 (356) 16 (406) 20 (508) 8 (208) 8 (208) 8 (208) 1 1 1 10 (5) 11 (5) 13 (6) Tiltout Wall Racks LWTR-series: RACK: Lowell’s Wall-mount Tiltout Racks provide secure installation for electronicequipment.Availablewithsurfaceorrecessedbackbox. Backbox(29" x29")forsurfacemodel(LWTR-3S)isflushwithkeyholeslotson16" centers.Backbox(26" x26")forrecessedmodel (LWTR-3R)requires4" depth.Bothstylesmountequipment19"Wx 5.25"(3U)Hx17.5"D.(482x133x445mm).Backboxandframeare packagedseparately.Networkgreypowderepoxyfinish.Features: Width: overallwidth:29" (737mm);rail-mountingwidth:19" EIA(483mm). Adjustable Rails: 7-positionrails,tapped10-32. Adjustable Height Hold-down Brackets: (2)tosecurenonrackmountconsumergear. Knockouts: forconduitaccess. Keyholes: for16" studmounting. Device cutouts with covers for optional accessories. Device Cutouts: withfactoryinstalledcoverplates.4external, 2internalforoptionalinstallationofDecora-styledevices(low voltageonly,notincluded). Ships via Integral E.O. Box: (1)single-gangbox,factorymountedto bottom. Lock: key-operatedlock. Hardware: PilotPoint™10-32screwswithwashers. OPTIONS: Thumb Latch (TLK): replaceskey-lock. Model No. Description LWTR-3R LWTR-3S OPTIONS TLK Wall-mount Tiltout Rack (recessed) Wall-mount Tiltout Rack (surface) Rack Units Overall D in. (mm) Former No. Overall H in. (mm) Usable D in. (mm) 3 3 17.5 (445) 17.5 (445) L87-5R L87-5S 29 (737) 29 (737) 18 (457) 18 (457) Thumb Latch Carton Wt. FR Carton Wt. BB lb. (kg) lb. (kg) 39 (18) 39 (18) 29 (13) 29 (13) 1 (0.5) --- LWTCR-series: RACK: Lowell’sWall-mountTiltoutControlled-releaseRacksincludeoil-filled dampersforsmoothoperation.Topcompartmentwithpocketdoor stores accessory devices or mounts (optional) 19" rack device panelsonhingedmountforeasyserviceaccess.Networkgrey. Shipsin2cartons. 3U area behind pocket door includes hinged rail. Surface Backbox Model (LWTCR-3S): 24.38"Wx32"Hx 6"Dprojection(619x813x152mm). Recessed Backbox Model (LWTCR-3R): features same backboxandframewithatrimplatebetweentofinishoutthe wall. Trim plate measures 27.37"W x 32"H (695 x 813mm) making the overall recessed assembly 27.37"W x 32"H x 4.25"Dx1.81" projection(695x813x108x46mm). Width: overallwidth:24.4" (620mm);rail-mountingwidth:19" EIA(483mm). Removable (3U) laptop shelf. Knockouts: forconduitaccess. Single lock secures top & bottom. Keyholes: for16" studmounting. Integral E.O. Box: single-gang box is factory mounted to bottom. Side Cable Raceway & Bottom Cable Area: hidewiring. Ventilated door features integral handle. Removable Shelf: cansupportalaptopcomputer. Ships via Hardware: PilotPoint™10-32screwswithwashers. OPTIONS: Thumb Latch (TLK): replaceskey-lock. Model No. Description LWTCR-3R LWTCR-3S OPTIONS TLK Wall-mount Tiltout Controlled-release Rack (recessed) Wall-mount Tiltout Controlled-release Rack (surface) Thumb Latch Rack Units Overall D in. (mm) Former No. 3 3 15 (381) 15 (381) L83-5R L83-5S Carton Wt. FR Carton Wt. BB lb. (kg) lb. (kg) 52 (24) 52 (24) 33 (15) 37 (17) 1 (0.5) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45 mm). 27 RACK VI: PULL-OUT RACKS Built-in Racks LPTR-series: RACK: Lowell’sPull&TurnRackhasanopen-frameandfeaturesheavydutyslidesforsmooth,pull-outaccesstorack-mountedequipment, makingthisanidealdesignforuseinsidecustomcabinetry.Pushbuttonlockeliminateslatchbindingwhileallowingtheracktorotate onaturntable(60˚/90˚).Rackbasesecurestoturntablebasewith screws on front and rear (no wing nuts under rack). Lock-out mechanismautomaticallyengagestokeeprackinfullyextended positionwhenservicingequipment.Availableintwodepths.Smooth blackpowderepoxyfinish.Shipsunassembled(2boxes).Features: The two-part design is engineered to fit inside cabinets while still allowing easy access to electronics. Width: overallwidth:19.13" (486mm);rail-mountingwidth: 19" EIA(483mm). Mounting Rails: featureprintedrackunitscaleandcutmarks toaidcustomfitinfield. Rack Base: 2cornerpostrails,tapped10-32,forfieldinstallation. Rackwith2slidesloadcapacity:150lbs.Rackwith4slides load-capacity:300lbs. Rack Equipment Frame: 4cornerpostrails,tapped10-32 forshop/fieldbuild. Cable Lacing Panels: 6panelsprovidedtoguidecabling. Front Security Panel: vented. OPTIONS: TOP COVER (LPTR-TC): steelcoverfortopofrack.Black. RACKWARE:® AccessoriesarelistedunderRackware® Accessories,ThermalManagementandCableManagement. LPTR-TC optional top cover. Rack slides out from frame & swivels right or left. Ships via Model No. Description Rack Units Overall D in. (mm) RACKS LPTR2-1019 Pull & Turn Rack, 2-slides 10 19 (489) LPTR2-1219 Pull & Turn Rack, 2-slides 12 19 (489) LPTR2-1619 Pull & Turn Rack, 2-slides 16 19 (489) LPTR2-2119 Pull & Turn Rack, 2-slides 21 19 (489) LPTR4-1019 Pull & Turn Rack, 4-slides 10 19 (489) LPTR4-1219 Pull & Turn Rack, 4-slides 12 19 (489) LPTR4-1619 Pull & Turn Rack, 4-slides 16 19 (489) LPTR4-2119 Pull & Turn Rack, 4-slides 21 19 (489) LPTR4-1023 Pull & Turn Rack, 4-slides 10 23 (590) LPTR4-1223 Pull & Turn Rack, 4-slides 12 23 (590) LPTR4-1623 Pull & Turn Rack, 4-slides 16 23 (590) LPTR4-2123 Pull & Turn Rack, 4-slides 21 23 (590) OPTIONS LPTR-TC Top Cover (for LPTR) SPECIAL STOCKING OPTIONS (For Distributors) LPTR-19B2 Base Only (2-slides, 19"D, no rails) LPTR-19B4 Base Only (4-slides, 19"D, no rails) LPTR-23B4 Base Only (4-slides, 23"D, no rails) LPTR-RRTC10 Rail Set (3-pr, with assembly hardware) LPTR-RRTC12 Rail Set (3-pr, with assembly hardware) LPTR-RRTC16 Rail Set (3-pr, with assembly hardware) LPTR-RRTC21 Rail Set (3-pr, with assembly hardware) 28 Former No. Overall H in. (mm) Usable D in. (mm) Carton Pack LPT2-1917 LPT2-1921 LPT2-1928 LPT2-1936 LPT4-1917 LPT4-1921 LPT4-1928 LPT4-1936 LPT4-2317 LPT4-2321 LPT4-2328 LPT4-2336 20 (508) 24 (610) 31 (787) 39 (991) 20 (508 24 (610) 31 (787) 39 (991) 20 (508) 24 (610) 31 (787) 39 (991) 19 (488) 19 (488) 19 (488) 19 (488) 19 (488) 19 (488) 19 (488) 19 (488) 23 (590) 23 (590) 23 (590) 23 (590) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) (2 boxes) Carton Wt. lb. (kg) 65 (29) 65 (29) 67 (30) 70 (32) 71 (32) 73 (33) 73 (33) 76 (34) 78 (35) 78 (35) 81 (37) 85 (39) 56 (25) 62 (28) 67 (30) 10 (4.5) 11 (5) 14 (6.5) 17 (7.5) Host Racks LHR-series: RACK: Lowell’sHostRack isatwo-partrackthatconsistsofanexterior unitandaninteriorrollout/rotatingrack.Itcombinestheadvantages of a small footprint with superior accessibility to mounted equipment, cables and wiring, making it ideal for multi-bay applications.Interiorrackswivelsonstainlesssteelballtransfers thatsupportloadsupto750lbs.Madewith100%certifiedU.S. steel.Bevelededgesonfourcorners.Mar-resistant,blackwrinkle powderepoxyfinish.Features: Width: overall width:(exterior) 24" (610mm);  rail-mounting width: 19" EIA(483mm). Exterior Unit: weldedsteelwithreinforcedventedsides,open front,openrearand10Uopeningintopwithsteelclosurepanels(describedbelow). Interior Unit: steelassemblywithpost-stylemountingrails, andside/rearbracesforstrength.Mountedtocasterbase.Interiorrackwithcasterbaseassemblycanberemovedfrom externalunit. Steel, Top Closure Panels: (2)16-gaugesteelpanels(3U& 4Uor3U&7Udependingonrackdepth)createaflushclosure fortopofrack.Panelsaremountedtofrontofrackduringshippingtoprovideadditionalstability.Topclosurepanelscanbe replacedwith(optional)fanpanelsforactivethermalmanagement. Corner Mounting Rails (fixed): (interiorunit)tapped10-32, featureaprintedscalethatfacilitatesequipmentinstallation. Cable Management: Top:6" deeprearknockoutplane;halfinchknockoutsalongsidesforBNCwirelessantennae.Rear: knockoutpanelslocatedaboveandbelowreardoorfeature multipleloomingoptions.Lacingpanelsthroughout. Hardware: PilotPoint™10-32screwswithwashers(50). OPTIONS: LHR-3532 Steel closure panels fit together to provide flush closure for top of exterior unit. Panels are included as standard equipment. Rack pivots on turntable (platform disengages from exterior unit for shop wiring). Removable knockout panels above & below rear door. Front Door (LHR-FD series): surface, steel door extends 1" (25.5mm)fromframeandincludeslockandkey.Mountsleftor rightwithoutdrilling,fieldchangeable.180˚swing.Fourbeveled edges.Blackwrinklepowderepoxyfinish. Solid: singlepiececonstructionforstrengthanddurability. Plexiglas: steelframewithsmokedPlexiglasinsert. Optional: vented rear access cover with lock & key. Rear Access Cover (LHR-RAC series): 14-gaugesteel,vented topandbottom.Lockingtoplatch. RACKWARE:® AccessoriesarelistedunderRackware® Accessories,ThermalManagementandCableManagement. Optional: surface front door in solid steel or steel frame with smoked Plexiglas insert. Model No. RACKS LHR-2432 LHR-3532 LHR-4432 LHR-3542 LHR-4442 OPTIONS LHR-RAC24V LHR-RAC35V LHR-RAC44V LHR-FD24 LHR-FD35 LHR-FD44 LHR-FD24P LHR-FD35P LHR-FD44P Description Interior Rack Units Exterior Overall D in. (mm) Exterior Overall H in. (mm) Interior Usable D in. (mm) Carton Pack Carton Wt. lb. (kg) Host Rack Host Rack Host Rack Host Rack Host Rack 24 35 44 35 44 33 (835) 33 (835) 33 (835) 43 (1089) 43 (1089) 54 (1368) 73 (1861) 89 (2261) 73 (1861) 89 (2261) 26 (660) 26 (660) 26 (660) 36 (914) 36 (914) 1 1 1 1 1 239 (108) 287 (130) 321 (145) 344 (156) 388 (176) 1 1 1 1 1 1 1 1 1 24 (11) 33 (15) 41 (19) 34 (15.5) 43 (19.5) 51 (23) 31 (14) 35 (16) 43 (19.5) Rear Access Cover (for LHR) Rear Access Cover (for LHR) Rear Access Cover (for LHR) Solid Front Door (for LHR) Solid Front Door (for LHR) Solid Front Door (for LHR) Plexiglas Front Door (for LHR) Plexiglas Front Door (for LHR) Plexiglas Front Door (for LHR) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45 mm). 29 RACK VII: CREDENZA RACKS Built-in Rack LCR-1216: RACK: Lowell’sCredenzaRack isa12Ulow-profile,weldedframedesigned for maximum equipment load space inside cabinetry or under countersordesks.Ruggedframeisalsosuitableforstandalone applications.Racktopandbottomareformedwith14-gaugesteel with11-ga.cornerpostrails(threaded10-32).All-weldedconstructionwith100%certifiedU.S.steel.Blacksemi-glosspowderepoxy finish.Shipsready-to-install.Features: LCR-1216 welded rack ships fully assembled and ready-to-install. Width: overallwidth:19.25" (489mm);rail-mountingwidth: 19”EIA(483mm). 0.938"H (24mm) Model No. Description Rack Units Overall D in. (mm) Former No. Overall H in. (mm) Usable D in. (mm) Carton Pack Carton Wt. lb. (kg) LCR-1216 Credenza Rack 12 16 (406) LCR-21 23 (584) 16 (406) 1 32 (15) X-series: RACK: X-seriesrackframescanbeassembledtostackverticallyorganged horizontally to create a variety of configurations. 14-gauge steel frameincludes4threadedcornerpostrailsandself-clinchingstuds forfastassembly.Availableintwostandardheights(8or14rack units).Another10or16rackunitscanbeaddedwiththe(optional) height expansion kit. Top and bottom vent panels can also be replacedwithequipment,foranadditional2unitsofrackspace. Made with 100% certified U.S. steel. Black semi-gloss powder epoxyfinish.Shipsasakitthatisassembledon-site.Features: X-series racks ship unassembled. Width: overallwidth:19.25" (489mm);rail-mountingwidth: 19" EIA(483mm). OPTIONS: Optional: SP-10 steel panel for top closure. Height Expansion Kit (XK-series): includessteelpanelsandrails thatwilladd10or16rackunitstorackheight. Additional Rack Rails (XRR-series): additionalmountingrailsfor middle-depthuse.Steel,adjustable.Soldinpairs. Optional: XCS swivel casters. Side Panels (XP-series): steel,vented(for20" rackdepth),1-pair. Swivel Casters (XCS):dualwheel,4-pack(125lbs.loadcapacity percaster).Castersincreaserackheightby1.75". Steel Top Closure Panel (SP-10): steelpanelcanbeusedastop closurepanelforX-seriesrack(20"D). Optional: XRRseries additional mounting rails. Optional: XK-series height expansion kit. Ships via Model No. RACKS X-820 X-1420 OPTIONS XK-1020 XK-1620 XRR-8 XRR-14 XP-820 XP-1420 SP-10 XCS 30 Description Rack Units Overall D in. (mm) Former No. Overall H in. (mm) Usable D in. (mm) Carton Pack Carton Wt. lb. (kg) X-series Rack Frame Kit X-series Rack Frame Kit 8 14 20 (511) 20 (511) X-1720 X-2820 18 (449) 28 (716) 20 (508) 20 (508) 1-kit 1-kit 25 (11) 30 (14) 1-kit 1-kit 1-pr 1-pr 1-pr 1-pr 1-ea 1-set 23 (10) 28 (13) 5 (2) 5 (2) 28 (13) 38 (17) 7 (3) 2 (1) Height Expansion Kit 10 Height Expansion Kit 16 X-series Rack Rails X-series Rack Rails X-series Side Panels 8 X-series Side Panels 14 Steel Panel (for top closure) 10 Dual-wheel Swivel Casters (set of 4) 20 (511) 20 (511) 20 (511) XK-1720 XK-2820 XRR-17 XRR-28 XP-1720 XP-2820 L3-1917 XC-4 20 (508) Desk Racks LDR-series: RACK: Lowell’sDeskRackisasturdymetal-furniture™rackfor19" (483mm) audio/video/controlequipment,idealforapplicationswheredesktop, underdesk/counter,orinsidecabinetmountingisdesired.Welded16gaugesteelontop,bottomandsides,finishedwithbeveledfrontcorneredgesandblack wrinklepowderepoxy.Loadcapacity:150lbs. Width: overall:22.45";rail-mountingwidth:19"EIA(483mm). Feet: protectiverubberfeet. Side Panels: ventedtopandbottom. Fixed Mounting Rails: 11-gaugesteeltapped10-32,located onfrontofrack. OPTIONS: Front Doors (LFD-series): seeRackOptions. Rear Access Cover (LDR-RAC series): ventedsteelpanelwith lockandkey. Fixed Rear Rails (LDR-RRT series): canalsobeusedwithrail conversionbracket. Conversion Bracket (RRTMB-F): optional bracket allows adjustable(middle-depth)mountingrails.Includeshardware. Casters (XCS): seeoppositepage(X-series). Protective Runner Kit (PRK): plasticglidesprovideprotectionfor woodsurfaceswheninstalledinsidecabinetry. Optional protective runner kit. Model No. Description Rack Units Overall D in. (mm) Overall H in. (mm) Usable D in. (mm) RACKS LDR-718 LDR-1018 LDR-1218 LDR-1418 LDR-1618 Desk Rack Desk Rack Desk Rack Desk Rack Desk Rack 7 10 12 14 16 18 (457) 18 (457) 18 (457) 18 (457) 18 (457) 15 (378) 20 (511) 23 (584) 27 (689) 30 (762) 17 (432) 17 (432) 17 (432) 17 (432) 17 (432) OPTIONS LDR-RRT7 LDR-RRT10 LDR-RRT12 LDR-RRT14 LDR-RRT16 LDR-RAC7V LDR-RAC10V LDR-RAC12V LDR-RAC14V LDR-RAC16V RRTMB-F PRK Additional Mounting Rails Additional Mounting Rails Additional Mounting Rails Additional Mounting Rails Additional Mounting Rails Rear Access Cover Rear Access Cover Rear Access Cover Rear Access Cover Rear Access Cover Conversion Bracket Protective Runner Kit 7 10 12 14 16 7 10 12 14 16 12.25 (311) 17.5 (445) 21 (533) 24.5 (622) 28 (711) Carton Pack Carton Wt. lb. (kg) 1 1 1 1 1 36 (16) 44 (20) 45 (20) 50 (23) 58 (26) 1-pr 1-pr 1-pr 1-pr 1-pr 1 1 1 1 1 1 kit 1 kit 3 (1.5) 3 (1.5) 4 (2) 4 (2) 5 (2.5) 6 (3) 8 (3.5) 9 (4) 11 (5) 13 (6) 6 (3) 3 (1.5) *Height with rubber feet. LDSR-series: RACK: Lowell’sDesktopSloped-frontRackisasturdy,16-gaugesteel, weldedturretthatfeaturesanopen-front/open-backdesignand12˚ slopeforeasyviewingofmountedequipment.Includes2bottom panelsmounted2.5" (64mm)fromfrontand2.5" (64mm)fromback providingthreeopenareasforcables.Beveledcorneredgesand protectiverubberfeet.Blackwrinklepowderepoxyfinish.Features: LDSR-series desktop rack. Width: overallwidth:21.125" (537mm);rail-mountingwidth: 19" EIA(483mm). Depth at Base: 17" (432mm). Ships via Welded (fixed) Mounting Rails: front(tapped10-32)and rear(punchedon0.281" (7mm)universalEIAspacing. Model No. Description Rack Units Overall D in. (mm) LDSR-617 LDSR-717 LDSR-817 LDSR-1017 LDSR-1117 Desktop Sloped-front Rack Desktop Sloped-front Rack Desktop Sloped-front Rack Desktop Sloped-front Rack Desktop Sloped-front Rack 6 7 8 10 11 17 (432) 17 (432) 17 (432) 17 (432) 17 (432) Former No. Overall H in. (mm) Usable D in. (mm) Carton Pack Carton Wt. lb. (kg) L40-10 L40-12 L40-14 L40-17 L40-19 13 (326) 15 (371) 16 (413) 20 (500) 21 (544) varied varied varied varied varied 1 1 1 1 1 25 (11) 26 (12) 28 (13) 32 (15) 33 (15) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45 mm). 31 RACK VIII: RACK OPTIONS Doors & Access Covers LFD-series: DOOR: ThestandardFrontDoor(LFD-series)isasurfacesteeldoorwith180˚ swingthatfitsrackmodelsLDR,LER,LER-F,LGR,LSER,LSER-F, LSGR,LPR,LPPR,andLWR-series.Doorextends1" fromframeand includesstandardlock/keyset.Mountsleftorrightwithoutdrillingand isfield-changeableevenafterequipmenthasbeeninstalled.Beveled edges,blackwrinklepowderepoxyfinish.Note:Modelswith“RL” (rearlock)suffixarekeyeddifferently—usewithdual-doorframewhen differentlocksaredesired(seenextpage).Threeversions: Solid: singlepiececonstructionforstrengthanddurability. Plexiglas: steelframewithsmokedPlexiglasinsert. Fully-Vented: allowspassiveheatdistribution. Model No. 32 SOLID LFD-7 LFD-7RL LFD-10 LFD-10RL LFD-12 LFD-14 LFD-14RL LFD-16 LFD-16RL LFD-21 LFD-21RL LFD-24 LFD-24RL LFD-35 LFD-40 LFD-44 PLEXIGLAS LFD-7P LFD-10P LFD-12P LFD-14P LFD-14PRL LFD-16P LFD-21P LFD-21PRL LFD-24P LFD-24PRL LFD-35P LFD-40P LFD-44P FULLY-VENTED LFD-7FV LFD-10FV LFD-12FV LFD-14FV LFD-14FVRL LFD-16FV LFD-21FV LFD-21FVRL LFD-24FV LFD-24FVRL LFD-35FV LFD-40FV LFD-44FV Description Solid Front Door (for 7U rack) Solid Front Door (for 7U rack), rear lock Solid Front Door (for10U rack) Solid Front Door (for10U rack), rear lock Solid Front Door (for 12U rack) Solid Front Door (for 14U rack) Solid Front Door (for 14U rack), rear lock Solid Front Door (for 16U rack) Solid Front Door (for 16U rack), rear lock Solid Front Door (for 21U rack) Solid Front Door (for 21U rack), rear lock Solid Front Door (for 24U rack) Solid Front Door (for 24U rack), rear lock Solid Front Door (for 35U rack) Solid Front Door (for 40U rack) Solid Front Door (for 44U rack) Former No. L2150-12 Carton Pack Carton Wt. lb. (kg) L2150-36 L2150-36-RL L2150-42 L2150-42-RL L2150-61 L2150-70 L2150-77 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 12 (5) 12 (5) 12 (5) 12 (5) 14 (6) 15 (7) 15 (7) 16 (7) 16 (7) 19 (9) 19 (9) 23 (10) 23 (10) 32 (15) 36 (16) 38 (17) Plexiglas Front Door (for 7U rack) Plexiglas Front Door (for 10U rack) Plexiglas Front Door (for 12U rack) Plexiglas Front Door (for 14U rack) Plexiglas Front Door (for 14U rack), rear lock Plexiglas Front Door (for 16U rack) Plexiglas Front Door (for 21U rack) Plexiglas Front Door (for 21U rack), rear lock Plexiglas Front Door (for 24U rack) Plexiglas Front Door (for 24U rack), rear lock Plexiglas Front Door (for 35U rack) Plexiglas Front Door (for 40U rack) Plexiglas Front Door (for 44U rack) L2150-12P L2150-17P L2150-21P L2150-24P L2150-24P-RL L2150-28P L2150-36P L2150-36P-RL L2150-42P L2150-42P-RL L2150-61P L2150-70P L2150-77P 1 1 1 1 1 1 1 1 1 1 1 1 1 11 (5) 12 (5) 13 (6) 14 (6) 14 (6) 15 (7) 17 (8) 17 (8) 21 (10) 21 (10) 26 (12) 28 (13) 32 (15) Fully-vented Front Door (for 7U rack) Fully-vented Front Door (for 10U rack) Fully-vented Front Door (for 12U rack) Fully-vented Front Door (for 14U rack) Fully-vented Front Door (for 14U rack), rear lock Fully-vented Front Door (for 16U rack) Fully-vented Front Door (for 21U rack) Fully-vented Front Door (for 21U rack), rear lock Fully-vented Front Door (for 24U rack) Fully-vented Front Door (for 24U rack), rear lock Fully-vented Front Door (for 35U rack) Fully-vented Front Door (for 40U rack) Fully-vented Front Door (for 44U rack) L2150-12PF L2150-17PF L2150-21PF L2150-24PF L2150-24PF-RL L2150-28PF L2150-36PF L2150-36PF-RL L2150-42PF L2150-42PF-RL L2150-61PF L2150-70PF L2150-77PF 1 1 1 1 1 1 1 1 1 1 1 1 1 10 (5) 11 (5) 12 (5) 13 (6) 13 (6) 13 (6) 16 (7) 16 (7) 20 (9) 20 (9) 24 (11) 26 (12) 30 (14) L2150-17 L2150-21 L2150-24 L2150-24-RL L2150-28 LRD-series: DOOR: ThestandardRearDoor(LRD-series)isarecessedsteeldoorwith 180˚swingthatfitsrackmodelsLER,LER-F,LGR,LSER,LSER-F, LSGR,LPR,andLPPR-series.Doormountsleftorrightwithout drillingandisfieldchangeable.Blackwrinklepowderepoxyfinish. Includeslockandkeyset.Twoversions: Many rack models include a vented rear door. To change to the fullyvented style shown here, order the rack without a rear door (rack model with LRD suffix), then order a fully-vented rear door (FV suffix) from the list below. Vented: singlepiececonstructionforstrengthanddurability, ventedtopandbottomforpassiveheatdistribution.Matches theventedreardoorsuppliedwithracksnotedabove. Fully-Vented: allowsenhancedfront-to-rearairflowforracks withafully-ventedfrontdoorornofrontdoor(openfront).Ideal forracksloadedwithamplifiersorserverswithself-contained coolingfans. Model No. VENTED LRD-14V LRD-21V LRD-24V LRD-35V LRD-40V LRD-44V FULLY-VENTED LRD-14FV LRD-21FV LRD-24FV LRD-35FV LRD-40FV LRD-44FV Vented. Fully-vented. Description Rack Units Former No. Carton Pack Carton Wt. lb. (kg) Vented Rear Door Vented RearDoor Vented Rear Door Vented Rear Door Vented Rear Door Vented Rear Door 14 21 24 35 40 44 L2160-24V L2160-36V L2160-42V L2160-61V L2160-70V L2160-77V 1 1 1 1 1 1 15 (7) 19 (9) 23 (10) 32 (15) 36 (16) 38 (17) Fully-Vented Rear Door Fully-Vented Rear Door Fully-Vented Rear Door Fully-Vented Rear Door Fully-Vented Rear Door Fully-Vented Rear Door 14 21 24 35 40 44 L2160-24PF L2160-36PF L2160-42PF L2160-61PF L2160-70PF L2160-77PF 1 1 1 1 1 1 13 (6) 16 (7) 20 (9) 24 (11) 26 (12) 30 (14) Dual-door Frame LDDF-series: FRAME: Lowell’sDual-DoorFrameisasurfacesteelframewiththreaded insertsthataccommodatestwoshortfrontdoorstoseparateand secureequipmentinasingleinstallation.FitsrackmodelsLER,LERF,LGR,LSER,LSER-F,LSGR,LPR,LPPR,andLWR-series.The 1”Dsteelframemountslikeastandarddooronleftorrighthinge. Framecanbeaddedtoanexistinginstallationanddoesnotuse panelspace.Blackwrinklepowderepoxyfinish. Ordertopandbottomdoorsseparately(LFD-series). LER rack shown with dual-door frame, Plexiglas top door and fullyvented bottom door. The LDDF dual-door frame accomodates two short (LFD-series) doors (sold separately). Model No. Description Rack Units Former No. Carton Pack Carton Wt. lb. (kg) LDDF-21 LDDF-24 LDDF-35 LDDF-40 LDDF-44 Dual-Door Frame (mounts LFD7 top & LFD14-RL bottom) Dual-Door Frame (mounts LFD10 top & LFD14-RL bottom) Dual-Door Frame (mounts LFD14 top & LFD21-RL bottom) Dual-Door Frame (mounts LFD16 top & LFD24-RL bottom) Dual-Door Frame (mounts LFD21 top & LFD24-RL bottom) 21 24 35 40 44 L46-36 L46-42 L46-61 L46-70 L46-77 1 1 1 1 1 19 (9) 20 (9) 22 (10) 24 (11) 25 (11) Side Panels Side panels are manufactured to fit specific rack models; see individualrackseriesforinformationandpricing. Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 33 Platform Base Stationary: BASE: LSB-series: the Stationary Base mounts inside the rack frame addingaplatformthat’sflushwithbottomrackspacetosupport heavyequipment.Itdoesnotincreaserackheight. Forusewith19" wideracks(LER,LER-FandLGR-series).Notforusewithseismiccertifiedracks.Seespecificrackmodelforsuitabilityandfit.Black. LSB-series stationary base. LSSB-series: theShallowStationaryBasefor22" or27"Drack mountsinsidetherackframe,providingasubfloorthat’s2.25" below bottomrackspacetomountaccessorydevices.Itdoesnotincrease rackheight.Forusewith19" wideracks(LER,LER-FandLGRseries).Notforusewithseismic-certifiedracks.Seespecificrack modelforsuitabilityandfit.Black. Model No. Description LSB-22 LSB-27 LSB-32 LSB-36 LSSB-22 LSSB-27 Stationary Base (for 22”D rack) Stationary Base (for 27”D rack) Stationary Base (for 32”D rack) Stationary Base (for 36”D rack) Shallow Stationary Base (for 22”D rack) Shallow Stationary Base (for 27”D rack) LSSB-series shallow stationary base. Former No. Carton Pack Carton Wt. lb. (kg) PB222 PB227 PB232 PB236 PBS222 PBS227 1 1 1 1 1 1 21 (10) 25 (11) 28 (13) 35 (16) 18 (8) 23 (10) Mobile: BASE: LMB-series: theMobileBasemountsinsidetherackframe,adding aplatformthat’sflushwithbottomrackspacetosupportheavy equipment.Itadds1.25" torackheight.Includes3" swivelcasters (350 lb. load capacity each). For use with 19" wide racks (LER, LER-FandLGR-series).Notforusewithseismic-certifiedracks.See specificrackmodelforsuitabilityandfit.Black. LMB-series mobile base. LMSB-series: theMobileShallowBaseisacartthatmountsunder therackframe,adding4.06" torackheight.Itincludes3" swivel casters—2locking(350lb.loadcapacityeach).Forusewith19" wide racks (LER, LER-F and LGR-series). Not for use with seismiccertifiedracks.Seespecificrackmodelforsuitabilityandfit.Black. LMSB-series mobile shallow base. Model No. Description Former No. LMB-27 LMB-32 LMB-36 LMSB-22 Mobile Base (for 27”D rack) Mobile Base (for 32”D rack) Mobile Base (for 36”D rack) Mobile Shallow Base (for 22”D rack) MB227 MB232 MB236 MBS222 Carton Pack Carton Wt. lb. (kg) 1 1 1 1 29 (13) 32 (15) 39 (18) 25 (11) Cable Chase LCC4-series: CABLE CHASE: Lowell’sCableChase(4"W)isengineeredtoprovideextrawiring spacebetweengangingracksorattheendofamulti-bayconfiguration. Available for 44U racks with 22"–36"D. Features beveled edges,bolt-onfront,rearandtopknockoutsandjoininghardware. Model No. Description LCC4-4422 LCC4-4427 LCC4-4432 LCC4-4436 Cable Chase 4”W (for 44U x 22”D rack) Cable Chase 4”W (for 44U x 27”D rack) Cable Chase 4”W (for 44U x 32”D rack) Cable Chase 4”W (for 44U x 36”D rack) Former No. Carton Pack Carton Wt. lb. (kg) L275-77CR L277-77CR L278-77CR L279-77CR 1 1 1 1 21 (10) 22 (10) 23 (10) 24 (11) Carton Pack Carton Wt. lb. (kg) 1 1 5 (2.3) 8 (3.6) Grounding Bus Bar GBB-series: GroundingBusBarsare0.125" copperwithlacingslotsandwiretie holes.2"W. 34 Model No. Description GBB-36 GBB-72 Grounding Bus Bar (36"L) Grounding Bus Bar (72"L) GBB-36 Decorative Work Surface (laminate top) LGT: TOP: Lowell’sGraphite-GreyTopforrackmodelsLER,LER-F,LPR,and LGR-series(except36"Dmodels)isa1"Hlaminatetopwithrubber edgemoldingthatincludesmountinghardware(10-32T-nutsand screws)toinstallintopEIApanelopeningwheretopclosurepanels normally mount. LPR-series racks feature center-punch indents in metaltoptoaccommodatethisoption—drillthroughindentstosecure. Model No. Description LGT-22 LGT-27 LGT-32 Graphite Grey Top (for 22”D rack) Graphite Grey Top (for 27”D rack) Graphite Grey Top (for 32"D rack) LGT graphite grey laminate top with rubber edge molding. Former No. Carton Pack Carton Wt. lb. (kg) GT-222 GT-227 1 1 1 18 (8) 25 (11) 30 (14) Rack Rails RRD-series: RackRailswithDual-holepatternaccommodatemultiplehardware preferences—tappedholesfor10-32screwsononeside,squarepunchedholesforcagenutswith12-24,10-32or6mmscrewson theotherside.Bothsideshaveaprintedscaleshowingrackunit measurementstoaidequipmentsetup.Mountinghardwareisincluded(seeRackAccessoriesforadditionalhardware).Railsfitrack modelsLER,LER-F,LGR,LSER,LSER-F,LSGR,LWR,LPRand LPPR-series.Soldinpairs.Note: rack models LHR, LLR, LVR, and X-series have mounting rails specifically engineered to fit. See specific rack model listings for part numbers and pricing of additional mounting rails. RAILS: Model No. Description RRD-7 RRD-10 RRD-12 RRD-14 RRD-16 RRD-21 RRD-24 RRD-35 RRD-40 RRD-44 Rack Rails Dual-hole pattern (for 7U rack) Rack Rails Dual-hole pattern (for 10U rack) Rack Rails Dual-hole pattern (for 12U rack) Rack Rails Dual-hole pattern (for 14U rack) Rack Rails Dual-hole pattern (for 16U rack) Rack Rails Dual-hole pattern (for 21U rack) Rack Rails Dual-hole pattern (for 24U rack) Rack Rails Dual-hole pattern (for 35U rack) Rack Rails Dual-hole pattern (for 40U rack) Rack Rails Dual-hole pattern (for 44U rack) RRD-series mounting rails can be field-reversed to access square-punched holes for alternate hardware needs. Former No. Carton Pack Carton Wt. lb. (kg) L212-12 L212-17 L212-21 L212-24 L212-28 L212-36 L212-42 L212-61 L212-70 L212-77 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 8 (3.5) 9 (4) 9 (4) 10 (4.5) 10 (4.5) 12 (5.5) 14 (6.5) 15 (7) 17 (7.5) 18 (8) RRT-series: RAILS: Rack Rails with Thin-flange fit 19.062-inch openings in custom millwork.Railsfeaturesingle-holepattern(tapped10-32).Soldin pairs.Note: mounting hardware is not included. Model No. Description Carton Pack Carton Wt. lb. (kg) RRT-10 RRT-12 RRT-16 RRT-21 RRT-24 RRT-32 RRT-40 RRT-46 Rack Rails Thin-flange (for 10U rack) — No Mounting Hardware Rack Rails Thin-flange (for 12U rack) — No Mounting Hardware Rack Rails Thin-flange (for 16U rack) — No Mounting Hardware Rack Rails Thin-flange (for 21U rack) — No Mounting Hardware Rack Rails Thin-flange (for 24U rack) — No Mounting Hardware Rack Rails Thin-flange (for 32U rack) — No Mounting Hardware Rack Rails Thin-flange (for 40U rack) — No Mounting Hardware Rack Rails Thin-flange (for 46U rack) — No Mounting Hardware 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 1-pr 9 (4) 9 (4) 10 (4.5) 12 (5.5) 14 (6.5) 15 (7) 17 (7.5) 18 (8) Knockout Panels PANELS: KnockoutPanelreplacementsforrackmodelsLER,LER-F,LGR,LWR, LPR,LPPR,andLWR-series.ModelKOPhasablankprojectareafor customuse.ModelKOP-Nfeaturesholesforupto12NeutrikD-series panelconnectors(6holesperpanel).Blackfinish.Soldinpairs(1-pair measures19.418"Wx2.687"H). KOP pair. KOP-N pair. Model No. Description Carton Pack Carton Wt. lb. (kg) KOP KOP-N Knockout Panel (blank) Knockout Panel (Neutrik D-series) 1-pr 1-pr 1 (0.5) 1 (0.5) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 35 RACK IX: RACKWARE® ACCESSORIES 19" EIA Panels Blank Panels: 19" PANELS: AFP-series: AluminumFlatPlanel.0.125", blackwrinklefinish. AP-series: AluminumPanel.16-gauge,flanged,blackwrinklefinish. Blank panel, flat. SP-series: SteelPanel.16-gauge,flanged,blackwrinklefinish. SEP-series: SteelEconomyPanel.18-gauge,flanged,blacksmoothsemiglossfinish. Blank panel, flanged. SEFP-series: SteelEconomyFlatPanel.14-gauge,blacksmoothsemi-gloss finish. Model No. 36 AFP-series AFP-1 AFP-1CC AFP-2 AFP-2CC AFP-3 AFP-3CC AFP-4 AFP-4CC AFP-5 AFP-6 AP-series AP-1 AP-1CC AP-2 AP-2CC AP-3 AP-3CC AP-4 AP-4CC AP-5 AP-6 SP-series SP-1 SP-1CC SP-2 SP-2CC SP-3 SP-3CC SP-4 SP-4CC SP-5 SP-6 SP-7 SP-8 SP-9 SP-10 SP-11 SP-12 SEP-series SEP-1 SEP-1CC SEP-1MC SEP-2 SEP-2CC SEP-2MC SEP-3 SEP-3CC Description Rack Units Former No. Carton Pack Carton Wt. lb. (kg) Aluminum Flat Panel Aluminum Flat Panel, Contractor Carton Aluminum Flat Panel Aluminum Flat Panel, Contractor Carton Aluminum Flat Panel Aluminum Flat Panel, Contractor Carton Aluminum Flat Panel Aluminum Flat Panel, Contractor Carton Aluminum Flat Panel Aluminum Flat Panel 1 1 2 2 3 3 4 4 5 6 L1-191 L1-191CC L1-193 L1-193CC L1-195 L1-195CC L1-197 L1-197CC L1-198 L1-1910 1 12 1 12 1 6 1 6 1 1 1 (.5) 6 (3) 1 (.5) 12 (5.5) 2 (1) 8 (3.5) 2 (1) 12 (5.5) 2 (1) 3 (1.5) Aluminum Panel (flanged) Aluminum Panel (flanged), Contractor Carton Aluminum Panel (flanged) Aluminum Panel (flanged), Contractor Carton Aluminum Panel (flanged) Aluminum Panel (flanged), Contractor Carton Aluminum Panel (flanged) Aluminum Panel (flanged), Contractor Carton Aluminum Panel (flanged) Aluminum Panel (flanged) 1 1 2 2 3 3 4 4 5 6 L2-191 L2-191CC L2-193 L2-193CC L2-195 L2-195CC L2-197 L2-197CC L2-198 L2-1910 1 12 1 12 1 6 1 6 1 1 1 (.5) 3 (1.5) 1 (.5) 5 (2.5) 1 (.5) 3 (1.5) 1 (.5) 6 (3) 1 (.5) 1 (.5) Steel Panel (flanged) Steel Panel (flanged), Contractor Carton Steel Panel (flanged) Steel Panel (flanged), Contractor Carton Steel Panel (flanged) Steel Panel (flanged), Contractor Carton Steel Panel (flanged) Steel Panel (flanged), Contractor Carton Steel Panel (flanged) Steel Panel (flanged) Steel Panel (flanged) Steel Panel (flanged) Steel Panel (flanged) Steel Panel (flanged) Steel Panel (flanged) Steel Panel (flanged) 1 1 2 2 3 3 4 4 5 6 7 8 9 10 11 12 L3-191 L3-191CC L3-193 L3-193CC L3-195 L3-195CC L3-197 L3-197CC L3-198 L3-1910 L3-1912 L3-1914 L3-1915 L3-1917 L3-1919 L3-1921 1 12 1 12 1 6 1 6 1 1 1 1 1 1 1 1 1 (.5) 12 (5.5) 2 (1) 21 (9.5) 3 (1.5) 13 (6) 3 (1.5) 16 (7.5) 4 (2) 4 (2) 5 (2.5) 5 (2.5) 6 (3) 7 (3) 7 (3) 8 (3.5) Steel Economy Panel (flanged) Steel Economy Panel (flanged), Contractor Carton Steel Economy Panel (flanged), Master Carton Steel Economy Panel (flanged) Steel Economy Panel (flanged), Contractor Carton Steel Economy Panel (flanged), Master Carton Steel Economy Panel (flanged) Steel Economy Panel (flanged), Contractor Carton 1 1 1 2 2 2 3 3 LE-191 LE-191CC LE-191MC LE-193 LE-193CC LE-193MC LE-195 LE-195CC 1 12 48 1 12 48 1 6 1 (.5) 12 (5.5) 43 (19.5) 2 (1) 21 (9.5) 57 (26) 2 (1) 12 (5.5) Model No. Description SEP-series (con’t.) SEP-4 Steel Economy Panel (flanged) SEP-4CC Steel Economy Panel (flanged), Contractor Carton SEP-5 Steel Economy Panel (flanged) SEP-6 Steel Economy Panel (flanged) SEFP-series SEFP-1 Steel Economy Flat Panel SEFP-1CC Steel Economy Flat Panel, Contractor Carton SEFP-1MC Steel Economy Flat Panel, Master Carton SEFP-2 Steel Economy Flat Panel Steel Economy Flat Panel, Contractor Carton SEFP-2CC SEFP-2MC Steel Economy Flat Panel, Master Carton SEFP-3 Steel Economy Flat Panel SEFP-3CC Steel Economy Flat Panel, Contractor Carton SEFP-4 Steel Economy Flat Panel SEFP-4CC Steel Economy Flat Panel, Contractor Carton SEFP-5 Steel Economy Flat Panel SEFP-6 Steel Economy Flat Panel Rack Units Former No. Carton Pack Carton Wt. lb. (kg) 4 4 5 6 LE-197 LE-197CC LE-198 LE-1910 1 6 1 1 3 (1.5) 14 (6.5) 4 (2) 4 (2) 1 1 1 2 2 2 3 3 4 4 5 6 LEF-191 LEF-191CC LEF-191MC LEF-193 LEF-193CC LEF-193MC LEF-195 LEF-195CC LEF-197 LEF-197CC LEF-198 LEF-1910 1 12 48 1 12 48 1 6 1 6 1 1 1 (.5) 8 (3.5) 48 (22) 2 (1) 16 (7) 74 (33.5) 2 (1) 12 (5.5) 3 (1.5) 17 (8) 4 (2) 4 (2) Vented Panels: 19" PANELS: SVP-series: SteelVentedPanel.20-gaugesteel,flanged,black smoothsemi-glossfinish. SVP-series panel SVSP-series: SteelVentedSlottedPanel.16-gaugesteel,flanged, blacksmoothsemi-glossfinish. Model No. SVP-series SVP-1 SVP-1CC SVP-2 SVP-2CC SVP-3 SVP-3CC SVP-4 SVP-4CC SVP-5 SVP-6 SVP-7 SVP-10 SVSP-series SVSP-1 SVSP-1CC SVSP-1MC SVSP-2 SVSP-2CC SVSP-2MC SVSP-series panel Rack Units Former No. Carton Pack Carton Wt. lb. (kg) Steel Vented Panel (flanged) Steel Vented Panel (flanged), Contractor Carton Steel Vented Panel (flanged) Steel Vented Panel (flanged), Contractor Carton Steel Vented Panel (flanged) Steel Vented Panel (flanged), Contractor Carton Steel Vented Panel (flanged) Steel Vented Panel (flanged), Contractor Carton Steel Vented Panel (flanged) Steel Vented Panel (flanged) Steel Vented Panel (flanged) Steel Vented Panel (flanged) 1 1 2 2 3 3 4 4 5 6 7 10 L5-191 L5-191CC L5-193 L5-193CC L5-195 L5-195CC L5-197 L5-197CC L5-198 L5-1910 L5-1912 L5-1917 1 12 1 12 1 6 1 6 1 1 1 1 1 (.5) 6 (3) 1 (.5) 10 (4.5) 1 (.5) 7 (3) 2 (1) 8 (3.5) 2 (1) 2 (1) 2 (1) 3 (1.5) Steel Vented Slotted Panel (flanged) Steel Vented Slotted Panel (flanged), Contractor Carton Steel Vented Slotted Panel (flanged), Master Carton Steel Vented Slotted Panel (flanged) Steel Vented Slotted Panel (flanged), Contractor Carton Steel Vented Slotted Panel (flanged), Master Carton 1 1 1 2 2 2 L6-191 L6-191CC L6-191MC L6-193 L6-193CC L6-193MC 1 12 48 1 12 48 1 (.5) 10 (4.5) 43 (19.5) 2 (1) 15 (7) 62 (28) Description Security Covers: 19" COVERS: SSC-series (with -V suffix): Steel Security Cover — Vented. 18-gaugesteel,flanged,blacksmoothsemi-glossfinish.Mountsin frontofrackequipment. Vented. Plexiglas. SSC-series (with -P suffix): SteelSecurityCover—Plexiglas. 18-gaugesteelwithPleixglasfront,flanged,blacksmoothsemiglossfinish.Mountsinfrontofrackequipment. Model No. VENTED SSC-1V SSC-2V SSC-3V SSC-4V PLEXIGLAS SSC-1P SSC-2P Rack Units Former No. Steel Security Cover, Vented (flanged) Steel Security Cover, Vented (flanged) Steel Security Cover, Vented (flanged) Steel Security Cover, Vented (flanged) 1 2 3 4 L9-191 L9-193 L9-195 L9-197 1 1 1 1 2 (1) 2 (1) 2 (1) 2 (1) Steel Security Cover, Plexiglas (flanged) Steel Security Cover, Plexiglas (flanged) 1 2 L9-191P L9-193P 1 1 2 (1) 2 (1) Description Carton Pack Carton Wt. lb. (kg) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 37 Panels with Device Cutouts: 19" PANELS: Steel rackmount panels with device cutouts present a simple, organized solution for mounting system devices, controls and connectorsinminimalrackspace.Blackfinish.Includeshardware. Doesnotincludecontrols(orderseparately). D4P-1 D4P-1: Decora-style4-holePanel– 1U.Mountslowvoltage deviceswithamaximumwidthof1.75" (horizontalorientation). Includeskep-nuthardware. SG6P-3 SG6P-3: SingleGang6-holePanel– 3U.Featurescutouts and clips to front-load up to 6 (1-gang, standard wallplate) devicesthatinstallwith2screws.Panelwasengineeredto resolve the problem of rack-mounting 1-gang devices that haveanon-removablefrontplate.Spacingisnotsuitablefor 2-gangdevices. Model No. Description D4P-1 SG6P-3 Decora-style 4-cutout Panel Single-Gang 6-cutout Panel Rack Units Former No. Carton Pack Carton Wt. lb. (kg) 1 3 LD4-RM LSG6-RM 1 1 2 (0.9) 5 (2.3) Panels with Device Cutouts & Pocket-ID™: 19" PANELS: Steelrackmountpanelswithcutoutspresentasimple,organized solutionformountingsystemdevices,controlsandconnectorsin minimalrackspace.Panelshaveablackfinishandincludeanoverlay (0.5"HPocket-ID® labelholder).Panelsdonotincludedevicecontrols (orderseparately). D3P-ID-1 D3P-ID-1: Decora-style3-holePanelwithPocket-ID™ – 1U. Flangedpanelhascutoutsforhorizontalorientationoflowvoltagedevices(max.width1.75").Includeslabelareanexttoeach cutoutandkep-nuthardware. D3P-ID-2 D3P-ID-2: Decora-style3-holePanelwithPocket-ID™ – 2U. Flangedpanelhascutoutsforhorizontalorientationofupto3 wide-body attenuators (like Lowell 200LVC or 150LVCS). Includeslabelareanexttoeachcutoutandkep-nuthardware. D8P-ID-3 D8P-ID-3: Decora-style8-holePanelwithPocket-ID™ – 3U. Flangedpanelhascutoutsfor8(1-gang,Decora-style)devices. Includeslabelareaabovecutoutsandkep-nuthardware.Order blankfillerplatesseparatelyforunusedpositions(DBB-4). D9P-ID-3 D9P-ID-3: Decora-style9-holePanelwithPocket-ID™ – 3U. Flangedpanelmounts(9)1-gangDecoradevicesor4multigangdevicesusingalternatespaces(ex.Lowellmodel200LVC or 150LVCS). Clearance for non-Lowell controls should be confirmed).IncludesPocket-ID™ labelareaabovecutoutsand kep-nuthardware.Orderblankfillerplates(DBB-4)separately tofillunusedpositions. IP-ID-1 N10P-ID-1 DBB-4: DecoraBlankBlackfillerplate(blacksatinfinish)is usedtofillunusedpositionsinpanelsD8P-ID-3andD9P-ID-3. LVC8P-ID-2 IP-ID-1: IdentificationPanelwithPocket-ID™– 1U.Flanged panelhaslabelareatoidentifyequipmentinstalledaboveand belowpanel. Pocket-ID® label area. N10P-ID-1: Neutrik-style10-holePanelwithPocket-ID™– 1U. Flangedpanelmountsupto10NeutrikD-seriesconnectorsor SwitchcraftE-series(notincluded).Includesblackandnickelplatedscrewsforconnectorinstallation.Blankfillerplatescan beordereddirectlyfromNeutrik(DBA). LVC8P-ID-2: LowellVolumeControl8-holePanelwithPocketID™– 2U.Flangedpanelmountsupto8Lowellvolumecontrols (LVC-RMseries,soldseparately).Includesfillerplugsforunused positions.Devicemountinghardwarenotincluded.Panelcan alsobeorderedwithpre-loadedvolumecontrols(pg.39). 38 Model No. Description D3P-ID-1 D3P-ID-2 D8P-ID-3 D9P-ID-3 DBB-4 IP-ID-1 N10P-ID-1 LVC8P-ID-2 Decora-style 3-hole Panel with Pocket-ID, 1U Decora-style 3-hole Panel with Pocket-ID, 2U Decora-style 8-hole Panel with Pocket-ID, 3U Decora-style 9-hole Panel with Pocket-ID, 3U Decora-style Blank Black (filler plate) 4 units per pack Identification Panel with Pocket-ID, 1U Neutrik-style 10-hole Panel with Pocket-ID, 1U Lowell Volume Control 8-hole Panel with Pocket-ID, 2U Rack Units Panel D9P-ID-3 is shown with volume controls and labels mounted in position. Controls are not included with panel and should be ordered separately (or see next page for allin-one ordering option). Pocket-ID™ label templates are available online (www.LowellMfg.com). Former No. 1 2 3 3 LD3-RMP LD3-RMP2 LD8-RMP LD9-RMP 1 1 2 LPID-RMP LN10-RMP LVC-RMP Carton Pack Carton Wt. lb. (kg) 1 1 1 1 4 1 1 1 2 (1) 3 (1.5) 5 (2.5) 5 (2.5) 1 (.5) 2 (1) 2 (1) 2 (1) Panels with Device Cutouts, Pocket-ID™ & Volume Controls: 19" PANELS: TheLVC8P-ID-2rackpanelcanbeorderedpre-loadedwithupto8 (LVC-series)volumecontrols.Selectthecontrolsyouwantfromthe listbelowandcreateacustommodelnumberusingtheletterdesignationsassignedforeachcontrol.Tocreatethenumber,startwith thepanelmodel(LVC8P-ID-2)thenplacealetterforeachofthe8 volumecontrolpositions.Note:volumecontrolsH**andI**arewide andrequire2spaces(4max.). LVC8P-ID-2 has 8 positions for volume controls. Panel Description LVC8P-ID-2 VolumeControl8-positionPanel(includesassembly) VC Module Description A 25LVC(25W,3dBstep) B 50LVC(50W,3dBstep) C 100LVC(100W,3dBstep) D 100LVC-PA(100W,3dBstep,priorityrelay) E 10015LVC(100W,1.5dBstep) F 10KLVC(10Kohm,lineartapercontrolfor 1 2 3 4 5 6 7 8 Sample Configuration & Model No. LVC8P-ID-2-AAABBEAC single-pointremoteadjustmentofvoltage controlledamplifiers-VCAs) G 50LVCS(50W,3dBstep,stereo,8ohm) H** 200LVC(200W,3dBstep,2-gang) I** 150LVCS(150W,3dBstep,stereo,70V,2-gang) N Emptyposition(holeplug) A A A B B E A C Note: LVC-series volume controls have phoenix-style removable screw termination strips for pre-wire with capacity for 14-gauge wire. Priority relay models (24VDC @ 5mA ) allow emergency and paging signals to bypass the attenuator. 19" EIA Shelves Utility Shelf: SHELF: US-series: UtilityShelf.16-gauge,openfront.10" or14"D.Black finish.Supportsupto50lbs.(22.6kg). USE-series: UtilityShelfforElectronics.16-gaugesteelpunched to mount chassis-style electronics includes front security panel. 10"D.Blackfinish.Supportsupto50lbs.(22.6kg). USVC-series: UtilityShelfVentedClamping.16-gaugesteel,open front.Featuresclampingbracketsandrearstopstosecurenonrackmountequipment.15"D.Supportsupto50lbs.(22.6kg). USVC-series US-series USE-series Model No. US-series US-110 US-110CC US-210 US-210CC US-310 US-114 US-214 US-214CC US-314 US-414 USE-series USE-210 USE-310 USVC-series USVC-215 USVC-315 USVC-415 Description Rack Units Depth in. (mm) Former No. Carton Pack Carton Wt. lb. (kg) Utility Shelf Utility Shelf, Contractor Carton Utility Shelf Utility Shelf, Contractor Carton Utility Shelf Utility Shelf Utility Shelf Utility Shelf, Contractor Carton Utility Shelf Utility Shelf 1 1 2 2 3 1 2 2 3 4 10 (254) 10 (254) 10 (254) 10 (254) 10 (254) 14 (356) 14 (356) 14 (356) 14 (356) 14 (356) L15-110 L15-110CC L15-310 L15-310CC L15-510 L15-114 L15-314 L15-314CC L15-514 L15-714 4 12 2 6 2 4 2 6 2 2 20 (9) 60 (27) 10 (4.5) 30 (13.5) 12 (5.5) 20 (9) 14 (6.5) 42 (19) 16 (7.5) 18 (8) Utility Shelf for Electronics Utility Shelf for Electronics 2 3 10 (254) 10 (254) L15-310E L15-510E 2 2 10 (4.5) 12 (5.5) Utility Shelf Vented Clamping Utility Shelf Vented Clamping Utility Shelf Vented Clamping 2 3 4 15 (381) 15 (381) 15 (381) L10-315 L10-515 L10-715 2 2 2 14 (6.5) 16 (7.5) 18 (8) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 39 RMK-series: 19" SHELF KIT: TheRackmountKitprovidesaprofessionalinstallationmethodfor non-rackmountequipment(upto17.375" wide).The14-gaugesteel shelf features vented bottom and vented/hinged sides for easy storageandinstallation.Separatefaceplateiscustom-fabricated toyourspecificationsandsecuresonstandardEIAspacingafter theshelfismountedsoyoucaninstalltheshelfandequipmentfirst and add the custom face plate later. Shelf and face plate are availableasakitorasindividualcomponents.Ifequipmentchanges, youcanreusetheshelfandorderanewfaceplatetofitthenew equipment. Rackmount Kit:*includes14" or18" deepshelf,customfaceplate and4“L-style”brackets.Faceplatehasablackepoxywrinklefinish. Customermustprovidemeasurementsforthecustomfaceplate. ThetemplateisavailableonlineatLowellMfg.com. The RMK-series rackmount shelf kit includes vented shelf, custom face plate, brackets and mounting hardware. The custom face plate mounts last, after shelf and equipment have been installed. The rackmount kit provides professional accommodations for non-rackmount equipment. INDIVIDUAL COMPONENTS: Rackmount Shelf Only (-LFP suffix): shelfonly—nofaceplate. 14" or18" deep.Includes4“L-style”brackets. Face Plate Only (-FP- designation):* customfaceplateonly— noshelf.Blackepoxywrinklefinish.Customermustprovidemeasurementsforthecustomdesign.Seethetemplateprovidedonline atwww.LowellMfg.com. OPTIONS: Hinged design allows rackmount shelf to ship flat. Top Clamp (RMK-TCMP): Full-widthtopclampsecuresequipmentthatislessthan16.125" wide. Custom face plate can be ordered as needed to accommodate new electronics. Rear Extension Brackets (RMK-RBKT-series): Brackets for installationsthatrequirerearrailsupportorcablelacing.Available intwodepths:11.5"L (for14"Dshelf)or15.5"L (for18"Dshelf). IMPORTANT: Note:whenacustomfaceplateisspecifiied,the orderisnotcompleteuntilmeasurementsareprovided.Atemplate isavailableonlineatLowellMfg.com.Whenfaceplatemeasurementsarereceived,Lowellwillcompletethepartno.andprocess theorder. Model No. Description RACKMOUNT KITS RMK2-14-(___)* Rackmount Shelf Kit (shelf & custom face plate) RMK3-14-(___)* Rackmount Shelf Kit (shelf & custom face plate) RMK4-14-(___)* Rackmount Shelf Kit (shelf & custom face plate) RMK5-14-(___)* Rackmount Shelf Kit (shelf & custom face plate) RMK2-18-(___)* Rackmount Shelf Kit (shelf & custom face plate) RMK3-18-(___)* Rackmount Shelf Kit (shelf & custom face plate) RMK4-18-(___)* Rackmount Shelf Kit (shelf & custom face plate) RMK5-18-(___)* Rackmount Shelf Kit (shelf & custom face plate) INDIVIDUAL COMPONENTS – SHELF ONLY RMK2-14-LFP Rackmount Shelf (less face plate) RMK3-14-LFP Rackmount Shelf (less face plate) RMK4-14-LFP Rackmount Shelf (less face plate) RMK5-14-LFP Rackmount Shelf (less face plate) RMK2-18-LFP Rackmount Shelf (less face plate) RMK3-18-LFP Rackmount Shelf (less face plate) RMK4-18-LFP Rackmount Shelf (less face plate) RMK5-18-LFP Rackmount Shelf (less face plate) INDIVIDUAL COMPONENTS – CUSTOM FACE PLATE ONLY RMK2-FP-(___)* Custom Face Plate (for 2U shelf) RMK3-FP-(___)* Custom Face Plate (for 3U shelf) RMK4-FP-(___)* Custom Face Plate (for 4U shelf) RMK5-FP-(___)* Custom Face Plate (for 5U shelf) OPTIONS RMK-RBKT-14 Rear Extension Bracket (for 14" deep shelf) RMK-RBKT-18 Rear Extension Bracket (for 18" deep shelf) RMK-TCMP Top Clamp (17.35" wide) 40 Optional rear extension brackets provide additional support and lacing area. Optional top clamp secures equipment that’s less than 16.125" wide. Rack Units Depth in. (mm) Carton Pack Carton Wt. lb. (kg) 2 3 4 5 2 3 4 5 14 (356) 14 (356) 14 (356) 14 (356) 18 (457) 18 (457) 18 (457) 18 (457) 1 1 1 1 1 1 1 1 11 (5) 12 (5.5) 12 (5.5) 13.5 (6) 13 (6) 13.5 (6) 14 (6.5) 15 (7) 2 3 4 5 2 3 4 5 14 (356) 14 (356) 14 (356) 14 (356) 18 (457) 18 (457) 18 (457) 18 (457) 1 1 1 1 1 1 1 1 11 (5) 11 (5) 11 (5) 12 (5.5) 12 (5.5) 12.5 (5.5) 13 (6) 13.5 (6) 1 1 1 1 13.5 (6) 13.5 (6) 13.5 (6) 13.5 (6) 1-pr 1-pr 1 6 (3) 6 (3) 3 (1.5) 2 3 4 5 11.5 (292) 15.5 (394) * Model number and order are not complete until measuresments for custom face plate are provided. See template online (www.LowellMfg.com). When measurements are received, Lowell will generate a custom part number and process the order. Writing / Laptop Shelves 19" SHELF: RSD-116: ReversibleShelf/Drawer,1U,16"D.Unique,reversible designcanbeinstalledasafixedwritingsurfaceorashallowdrawer. Slide-outdesignfeaturesanintegralpull.80lb.loadcapacity. The reversible RSD-116 can be installed for use as a shallow drawer or writing surface. FWS-215: FixedWritingSurface,2U,15"D.Woodlaminatefinish, 30lb.loadcapacity. The FWS-215 features a wood laminate finish. Model No. Description RSD-116 FWS-215 Reversible Shelf / Drawer Fixed Writing Surface Rack Units 1 2 Depth in. (mm) 16 (406) 15 (381) Former No. Carton Pack LWS-116 L16-3 1 1 Carton Wt. lb. (kg) 15 (7) 13 (6) Keyboard / Monitor Shelves 19" SHELF: KDMS: KeyboardDrawer/MonitorShelfengineeredtomount extended(18")keyboardandsupportafull-sizecomputermonitor. Heavy-dutyassemblyfeaturesaslide-outshelfwithrotatingtraythat swivels for keyboard access. Snap-closure panel secures the drawerwhennotinuse.Includesfull-lengthwristpadandmouse platformthatslidesoutforright-orleft-handuse.Drawer(19"Wx 20"Dwith16" extension)mountsonfrontandrearrailsandisreinforcedontoptosupportheavyequipment.Blackpowderepoxyfinish.Note:becausetheKDMS-seriesshelfaccommodatesavariety ofmonitorheightsitisnotastandardEIApanelheight.Actualshelf heightis4.34". KDMS-series shelf is reinforced to support a monitor and extended keyboard. Includes wrist guard and mouse platform. KDMSL: sameasabovewithlockandkey. Height in. (mm) Model No. Descripton KDMS KDMSL Keyboard Drawer / Monitor Shelf Keyboard Drawer / Monitor Shelf (locking) 4.34 (110) 4.34 (110) Depth in. (mm) Former No. Carton Pack Carton Wt. lb. (kg) 20 (508) 20 (508) L29K L29KL 1 1 31 (14) 31 (14) Variable Depth or Variable Width Shelves 19" SHELF: VDS-series: VariableDepthShelf.Steelshelfadjustsfrom20" to 32" deepforusein27",32" or36" deepracks.Loadcapacityupto 250lbs.Requiresfrontandrearrailsupport.Black. VWS-series: VariableWidthShelf.Steelshelfadjustsfrom17.5" to22" wide,providingsupportfornon-rackmountequipmentthat iswiderthanthemountingrailclearanceof17.813" on19" wide racks.Three-pieceunitmountsbehindrails.Sidesupportscanbe installedwitheitherlongorshortsideuptoemulatesideheightof 2Uor3Ushelfwithoutusingfrontmountingrailspace.5.25"Hx 14" or18"D.Black. Model No. Description VARIABLE DEPTH VDS-2-2032 Variable Depth Shelf VARIABLE WIDTH VWS-214 Variable Width Shelf VWS-218 Variable Width Shelf Rack Units 2 Width in. (mm) VDS shelf extends to 32" deep. VWS-series. 3-piece shelf mounts behind the rail, extends up to 22" wide. Depth in. (mm) Former No. Carton Pack Carton Wt. lb. (kg) 17.4 (442) variable L15-3X 1 17 (7.5) variable variable 14 (356) 18 (457) LWX-314 LWX-318 1 1 13 (6) 14 (6.5) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 41 19" EIA Storage Drawers 19" EIA: Storagedrawersandboxesfeaturefullyweldedconstructionand 16-gaugesteel.UnitsmounttofrontrackrailsusingstandardEIA spacing.Blackpowderepoxyfinish. SBL-series: StorageBoxwithLockfeaturessolidfrontdoor andrecessedhandle.Doorishingedatthebottomandsecuredwithsafetychainstops.Loadcapacity:50lbs. UDE-series: Utility Drawer Economy features ball-bearing slides.Loadcapacity:50lbs. SBL-series UDEL-series: UtilityDrawerEconomywithLockfeaturesballbearingslidesandkeylock.Loadcapacity:50lbs. UDP-series: UtilityDrawerPremiumfeaturesrecesseddrawer pullandslam-latchwithkeylock.Loadcapacity:50lbs.19"W x14.437"D(variedheights). Model No. SBL-series SBL-39 SBL-49 UDE-series UDE-214 UDE-314 UDE-414 UDEL-series UDEL-214 UDEL-314 UDEL-414 UDP-series UDP-214 UDP-314 UDP-414 UDP-614 Rack Units Former No. Storage Box with Lock Storage Box with Lock 3 4 L20-195 L20-197 Utility Drawer, Economy Utility Drawer, Economy Utility Drawer, Economy UDEL-series UDP-series Carton Pack Carton Wt. lb. (kg) 9 (229) 9 (229) 1 1 16 (7.5) 18 (7.5) 2 3 4 14.437 (367) 14.437 (367) 14.437 (367) 1 1 1 16 (7.5) 19 (8.5) 21 (9.5) Utility Drawer, Economy (locking) Utility Drawer, Economy (locking) Utility Drawer, Economy (locking) 2 3 4 14.437 (367) 14.437 (367) 14.437 (367) 1 1 1 17 (7.5) 20 (9) 22 (10) Utility Drawer, Premium Utility Drawer, Premium Utility Drawer, Premium Utility Drawer, Premium 2 3 4 6 14.437 (367) 14.437 (367) 14.437 (367) 14.437 (367) 1 1 1 1 27 (12) 32 (14.5) 38 (17) 46 (21) Description Depth in. (mm) Media Holders STORAGE: Mediaholdersfeaturefullyweldedconstructionand16-gaugesteel. UnitsmounttofrontrackrailsusingstandardEIAspacing. MH-6-VHS: MediaHolder– 6U– VHS.Unitisdesignedto hold up to 16 VHS tapes. Includes metal dividers. 4.44"D. Blackpowderepoxyfinish. MH-4-CD: MediaHolder– 4U– CD.Unitisdesignedtohold upto40CDorDVDmedia.Includesmetaldividers.5.75"D. Blackpowderepoxyfinish. 42 Model No. Description MH-6-VHS MH-4-CD Media Holder (for VHS format) Media Holder (for CD/DVD format) MH-4-CD MH-6-VHS Rack Units Former No. Depth in. (mm) Carton Pack Carton Wt. lb. (kg) 6 4 L21-1910 L22-197 4.438 (113) 5.75 (146) 1 1 11 (5) 9 (4) Rack Hardware Screws: Rack Screws – PilotPoint™: fortappedrailsorpunchedrailswith 10-32cagenuts,featurestipwithcaptivewasherfortime-saving installation.Black. RSP-25, RSP-100, RSP-500: PhillipsFinishHead.10-32x.875. RS-25, RS-100, RS-500: PhillipsTrussHead.10-32x.875. RSV-50: TorxStarPostHead.10-32x.875. RSV-BIT: TorxPin-driveBit. RSR-50: RobertsonSquareHead,10-32x.875. RSR-BIT: RobertsonPin-driveBit. Rack Screws – for Square Punched Rails: Black. RS1224-100: PhillipsPanHeadwithwashers.12-24x.787. RS6MM-100: PhillipsPanHeadwithwashers.6mm-m6 1x2cm. RCN cage nuts. RSP RS Rack Cage Nuts for Square Punched Rails: Black. RCN-1224-100: RackCageNuts(12-24). RCN-6MM-100: RackCageNuts(6mm). RCN-1032-100: RackCageNuts(10-32). Casters: Casters: nowsoldassets(4casters). C3S: Casters– 3" Swivel.350lb.loadcapacityea.,setof4. C3SL: Casters– 3" SwivelLocking.Sameasabovebutset includes1-pairswiveland1-pairswivel-locking. Casters for LVR-series: seeVari-Rack™ Miscellaneous: Ganging Hardware, Clips: RGH-40: RackGangingHardware.(1/4–20x5/8 hexandkepnuts). RC-100: RackClips.Tinnerman-style,10-32. RSV RSR C3S C3SL Replacement Keys: LK-FD: LowellKey– FrontDoor.(Series2150,B399A).1-pr. LK-RD: LowellKey– RearDoor.(Series2150,B644A).1-pr. LL leg levelers. Latch (TLK): Thumb-turncamLatchreplaceskey-lockcylinder. Leg Levelers (LL): heavyduty. Rack Light (RL-1): utilitylighthangsormounts(magnetically)to rack. Includes 13W fluorescent bulb with shatter-resistant lens, grounded120Voutlet(13A),2collapsibleswivelhooks,detachable bracket with magnet, plastic yellow housing, and (16-ga.) 6-ft. groundedcord.UL-Listed. Model No. Description SCREWS RSP-25 Rack PilotPoint™ Screws (Phillips Finish Head) 25 pieces per bag RSP-100 Rack PilotPoint™ Screws (Phillips Finish Head) 100 pieces per bag RSP-500 Rack PilotPoint™ Screws (Phillips Finish Head) 500 pieces per jar RS-25 Rack PilotPoint™ Screws (Truss Head) 25 pieces per bag RS-100 Rack PilotPoint™ Screws (Truss Head) 100 pieces per bag RS-500 Rack PilotPoint™ Screws (Truss Head) 500 pieces per jar RSR-50 Rack PilotPoint™ Screws (Robertson Square Head) 50 pieces per bag RSV-50 Rack PilotPoint™ Screws (Torx Star Security Head) 50 pieces per bag RSR-BIT Pin Drive Bit (for RPSR-series) RSV-BIT Pin Drive Bit (for RPSV-series) RS1224-100 Rack Screws (12-24 Phillips pan head) 100 pieces per bag RS6MM-100 Rack Screws (6mm Phillips pan head) 100 pieces per bag RCN1032-100 Rack Cage Nuts (10-32) 100 pieces per bag RCN1224-100 Rack Cage Nuts (12-24) 100 pieces per bag RCN6MM-100 Rack Cage Nuts (6 mm) 100 pieces per bag CASTERS C3S Casters 3" Swivel (2-pr) C3SL Casters 3" Swivel (1-pr) and Swivel-locking (1-pr) MISCELLANEOUS RGH-40 Rack Ganging Hardware (1/4–20 x 5/8 ) 40 pieces per bag RC-100 Rack Clips (10-32 Tinnerman) 100 pieces per bag LK-FD Lowell Key – Front Door (1-pr) LK-RD Lowell Key – Rear Door (1-pr) TLK Thumb-turn Cam Latch LL Leg Levelers (set of 4) RL-1 Rack Light RL-1Bulb Rack Light Bulb RL rack utility light. Former No. (L191A) (L192A) L204 L203 L195 Unit of Sale Carton Wt. lb. (kg) bag bag jar bag bag jar bag bag each each bag bag bag bag bag 1 (.5) 1 (.5) 6 (3) 1 (.5) 1 (.5) 6 (3) 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) 2 (1) 2 (1) 2 (1) 2-pr 2-pr 6 (3) 6 (3) bag bag 1-pr 1-pr each set each each 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) 4 (2) 1 (.5) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 43 RACK X: CABLE MANAGEMENT Horizontal-mount Bars & Panels: STACKABLE: CMBS-series: CableManagementBarSlotted.Barsareformed from14-gaugesteelforlacingwiresandcablesandmeasureappoximately19"W (483mm)x0.625"H(16mm).Availablestraightor offset(2",4" or6"D).Offsetbarsarestackableonahorizontalplane tosaverackspace.Straightbarcanbeusedaloneormountedat arightangletoanotherstraightbar,foradual-lacingconfiguration in1Uspace.Barscanalsobeusedassupportbracingforequipmentwhenusedwithmid-orrear-railrackapplications.Blackfinish. Soldinpacksof10. CMBS (straight) CMBS-6 (6"offset) CMFW cable managers can be combined and stacked in a horizontal plane, as shown here, to save rack space. CMFW-series: CableManagementFlatWire.Cablemanagerswith tiedownslotsandholesaremadewith11-gaugesteelandfeature unique,non-abrasive,smoothroundededge.Robustdesigncanbe usedassupportbracingforequipmentwhenusedwithmid-orrearrailrackapplications.Availablestraightoroffset(2" or4"D).Offset barsarestackableonahorizontalplanetosaverackspace.Black finish.Soldinpacksof10. STANDARD: CMC-1HV CMCD-1HV CMC-1HV: Cable Manager with Clips. Plastic flex-clips rotate individually.Blackfinish.Soldindividually. CMCD-1HV: CableManagerwithClipsandD-rings.Plasticflexclipsrotateindividually.SteelD-ringsareformedfrom0.25" (6mm) coldrolledsteel,weldedforstability.Blackfinish.Soldindividually. CMD-2H CMD-series: CableManagerwithD-rings.D-Ringsareformed from0.25" (6mm)coldrolledsteelandweldedforstabilityofmedium tolargecablebundles.Blackfinish.Soldindividually. CMD-2HV CMD-series with -HV suffix: sameasabove(CMD-series)but includesD-ringsonendsforverticalcableruns.Soldindividually. CMHT-series: CableManagerHorizontalTelescoping.Steelwith blackfinish,availableintwosizes:17"-30"Wx1Uor19"-36"Wx2U. Soldinpacksof2. CMHT2-1936 CMPS-2 CMPS-series: CableManagementPanelSlotted.Steelpanelfor lacingwiresandcablesmeasuresapproximately19"W (483mm). Smoothblackfinish.Soldinpacksof10. CMR CMR-series: Cable Management Rod. Rods are formed from 0.25" (6.35mm)diametercoldrolledsteel.Availablestraightoroffset. Blackfinish.Soldinpacksof10. Model No. 44 STACKABLE CMBS CMBS-2 CMBS-4 CMBS-6 CMFW CMFW-2 CMFW-4 STANDARD CMC-1HV CMCD-1HV CMD-1H CMD-2H CMD-1HV CMD-2HV CMHT1-1730 CMHT2-1936 CMPS-1 CMPS-2 CMR CMR2 CMR4 CMR4 Former No. Unit of Sale Carton Wt. lb. (kg) Cable Management Bar Slotted (straight) 10 per pack Cable Management Bar Slotted (2" offset) 10 per pack Cable Management Bar Slotted (4" offset) 10 per pack Cable Management Bar Slotted (6" offset) 10 per pack Cable Management Flat Wire (straight) 10 per pack Cable Management Flat Wire (2" offset) 10 per pack Cable Management Flat Wire (4" offset) 10 per pack LCMP pack pack pack pack pack pack pack 5 (2.5) 8 (3.5) 10 (4.5) 13 (6) 4 (2) 4 (2) 5 (2.5) Cable Manager with Clips – 1U Cable Manager with Clips & D-rings – 1U Cable Manager with D-rings – IU Cable Manager with D-rings – 2U Cable Manager with D-rings – 1U Cable Manager with D-rings – 2U Cable Manager Horizontal Telescoping – 1U, 2 per pack Cable Manager Horizontal Telescoping – 2U, 2 per pack Cable Management Panel Slotted – 1U, 10 per pack Cable Management Panel Slotted – 2U, 10 per pack Cable Management Rod (straight) 10 per pack Cable Management Rod (1.5" offset) 10 per pack Cable Management Rod (4" offset) 10 per pack LCM-1 LCM-1V LCMD-1H LCMD-2H LCMD-1HV LCMD-2HV each each each each each each pack pack pack pack pack pack pack 1 (.5) 2 (1) 2 (1) 3 (1.5) 2 (1) 3 (1.5) 10 (4.5) 19 (8.5) 6 (3) 12 (5.5) 10 (4.5) 10 (4.5) 10 (4.5) Description LCRS LCRS4 Vertical-mount Bars & Accessories: BARS: CMV-series: Cable Management Vertical-mount bar for lacing wiresandcablesincludesscrewsandnutslides.Blackfinish. CMV2-18: 2"Wx31.5"L(18U)withholes. CMV2-44: 2"Wx77"L(44U)withholes. CMV3-24: 3.25"Wx42"L(24U)withvelcroposttie,square holesandroundholes. CMD-2V CMV3-35: 3.25"Wx61.25"L(35U)withvelcroposttie,square holesandroundholes. CMV3-40: 3.25"Wx70"L(40U) withvelcroposttie,square holesandroundholes. CMV3-44: 3.25"Wx77"L(44U) withvelcroposttie,square holesandroundholes. CMV5-24: 4.75"Wx42"L(24U)withvelcroposttie,lance, squareholesandroundholes. CMV5-35: 4.75"Wx61.25"L(35U) withvelcroposttie,lance, squareholesandroundholes. CMV5-40: 4.75"Wx70"L(40U) withvelcroposttie,lance, squareholesandroundholes. CMV5-44: 4.75"Wx77"L(44U) withvelcroposttie,lance, squareholesandroundholes. D-RING: CMD-2V: CableManagementD-ring.Steelwithblackfinish. Model No. Description CMV2-18 CMV2-44 CMV3-24 CMV3-35 CMV3-40 CMV3-44 CMV5-24 CMV5-35 CMV5-40 CMV5-44 CMD-2V Cable Management Vertical-mount bar (2" x 18U) 6 per pack Cable Management Vertical-mount bar(2" x 44U) 6 per pack Cable Management Vertical-mount bar (3.25" x 24U) 6 per pack Cable Management Vertical-mount bar (3.25" x 35U) 6 per pack Cable Management Vertical-mount bar (3.25" x 40U) 6 per pack Cable Management Vertical-mount bar(3.25" x 44U) 6 per pack Cable Management Vertical-mount bar (4.75" x 24U) 6 per pack Cable Management Vertical-mount bar (4.75" x 35U) 6 per pack Cable Management Vertical-mount bar (4.75" x 40U) 6 per pack Cable Management Vertical-mount bar (4.75" x 44U) 6 per pack Cable Management D-ring Former No. Unit of Sale CLB-32 CLB-77 pack pack pack pack pack pack pack pack pack pack each LCMD CMV5-24 CMV3-24 CMV2-18 Carton Wt. lb. (kg) 24 (11) 36 (16.5) 12 (5.5) 19 (8.5) 21 (9.5) 23 (10.5) 17 (7.5) 26 (12) 29 (13) 32 (14.5) 1 (.5) Bushings & Cable Wraps BUSHINGS: LGRB-12: GangingRackBushingsareusedtoprotectcablethat runsbetweengangingracks.Plasticbushingssnapintoaccess holesalongthe(rear)verticalsidesoftherack.12bushingsperbag. WRAPS: VCW-12: VelcroCableWrapsaresuitableforlight-dutysettings (up to 200 re-fastenings). Ideal for AV connections, networking equipment or to hold cables out of the way during installation. Wrapsmeasureapproximately8" long(203mm)x0.5" high(13mm). Maximumbundlediameter1.75" (44mm).12wrapsperbag. Model No. Description LGRB-12 VCW-12 Ganging Rack Bushings, 12 per bag Velcro Cable Wraps, 12 per bag LGRB-12 VCW-12 Former No. Unit of Sale Carton Wt. lb. (kg) PTB-12 bag bag 1 (.5) 1 (.5) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 45 RACK XI: THERMAL MANAGEMENT Fans 19" EIA FAN PANELS: Steelfanpanelsmountinstandard19"EIAopenings.The3Uand 7Upanelsmayalsobeplacedatthetopoftherack,replacingthe solidclosurepanelsthatcomewithmanymodels.Black. WHISPER: FW2-3: Fan-panelwith2Whisper-stylefans.3U.Fansare4.7", 50cfmeach.Includesfrontguardand6' cord. FW2-3 FW3-3 FW4-7 FT1-7 FW3-3: Fan-panelwith3Whisper-stylefans.3U.Fansare4.7", 50cfmeach.Includesfrontguardand6'.cord. FW4-7: Fan-panelwith4Whisper-stylefans.7U.Fansare4.7", 50cfmeach.Includesfrontguardand6' cord. FW-FF: FanFilterfor4.7"fan. TURBO: FT1-7: Fan-panelwith1Turbo-stylefan.7U.Fanis10",550cfm. Includesfrontguard,rearguardand6' cord. Model No. Description FW2-3 FW3-3 FW4-7 FW-FF FT1-7 Fan-panel with 2 Whisper-style fans (3U) Fan-panel with 3 Whisper-style fans (3U) Fan-panel with 4 Whisper-style fans (7U) Fan Filter (for whisper-style 4.7" fan) Fan-panel with 1 Turbo-style fan (7U) Rack Units Former No. Carton Pack Carton Wt. lb. (kg) 3 3 7 LWF-195-2 LWF-195-3 LWF-1912 L39 L35-1912 1 1 1 1 1 6 (3) 7 (3) 10 (4.5) 10 (4.5) 10 (4.5) 7 Single-fan Kit: WHISPER: FW1-KIT: FanKitforsingle,Whisper-stylefan.Idealfortargeted cooling.Steelpanelmountstorearrackdoororventedsidepanels. One4.7"fan(50cfm)withfrontguardand6' cord.Black. Model No. Description FW1-KIT Fan Kit with 1 Whisper-style fan FW1-KIT Former No. Carton Pack Carton Wt. lb. (kg) LWF-KIT 1 2 (1) Rear Door Fan Panel: FAN: FW2-RD: mountsinsideoroutsidereardoor.Forusewithrack models:LGR,LER,LER-F,LPR,LPPR,LSGR,LSER,andLSER-F series.Lowprofileassemblyisonly2"D.Includestwo4.7"(50cfm) whisperfanswithguardsand6' cord.Black. Model No. Description FW2-RD Fan (Whisper-style, 2-fans) for Rear Door FW2-RD Former No. Carton Pack Carton Wt. lb. (kg) LWF-RD-2 1 6 (3) Fan Thermostat Control CONTROL: 46 FTC-1: equipment-saving accessory allows you to preset the temperatureatwhichfansautomaticallyturnontocoolrackmounted equipment,reducingfanoperationtimeandtheexcessivedirt-intake oftenattributedtocontinuouslyoperatingfans.Compactassembly (10"Lx3"Wby3"D)mountsinsiderack.Temperaturerange:50˚Fto 90˚F.Assemblyincludes15ampduplexreceptacleforfanplug-in, UL-Listed bimetallic thermostat with thermometer, 6' cord with moldedplug,andLEDindicatorsforstand-byandonfunctions. FTC-1 Model No. Description Former No. Carton Pack Carton Wt. lb. (kg) FTC-1 Fan Thermostat LTC-1 1 4 (2) POWER I: 19" EIA RACKMOUNT PANEL Stand-alone Corded 15A: ACR-1509: 15Apowerpanelwith5switchedand4unswitchedoutlets(including 1 on front). 1U chassis. Includes 9' cord with NEMA 5-15P (15A) plug. ETL-Listed. ACSPR-1509: 15Apowerpanelwith5switchedand4unswitchedoutlets(including1onfront).1Uchassis.Includes9' cordwithNEMA5-15P(15A)plug. Features advanced surge suppression with GSA GradeA–Mode1–Class1 endurance,UL1449-2andANSIC62.41compliance.TCR™technologydefeats surgesupto72,000AandprovidesexcellentEMI/RFIfiltering.ETL-Listed.  ACSPR-1509-VTE: 15Apowerpanelwith5switchedand4unswitchedoutlets (including1onfront).1Uchassis.Includes9' cordwithNEMA5-15P(15A)plug. Features advanced surge suppression with GSA GradeA–Mode1–Class1 endurance,UL1449-2andANSIC62.41compliance.TCR™technologydefeats surgesupto72,000AandprovidesexcellentEMI/RFIfiltering.Alsofeatures VoltageToleranceEnvelope™(VTE)—over/undercircuitrywithautoresetthat turnsallreceptaclesoffwhenlinevoltageexceeds140Vordropsbelow100V. Followingavoltagetoleranceshutdown,unitautomaticallyrestorespowerto receptacleswhenitdetectsacceptablelinevoltage.Ifpowerisinterruptedwhile VTEisactivated,switchedoutletsdefaulttoOFF.ETL-Listed. ACSPR-1509 front back ACR-2009 front back UL-181-RL U181RL: 15Apowerpanelwith(4duplex)rearswitchedoutlets,fronton/off rockerswitch,pilotlightanddownwarddeflectinglamptoilluminateequipment mountedbelowunit.1Uchassis.Includes6' cordwithNEMA5-15P(15A)plug. UL-recognized. Lamp illuminates equipment mounted below panel. U181RL-LC: sameasabovebutwithlongercord(15'). 20A: ACR-2009: 20A power panel with 5 switched and 4 unswitched outlets (including1onfront).1Uchassis.Includes9' cordwithNEMA5-20P(20A)plug. ETL-Listed. ACSPR-2009-VTE ACSPR-2009: 20Apowerpanelwith5switchedand4unswitchedoutlets (including1onfront).1Uchassis.Includes9' cordwithNEMA5-20P(20A)plug. Features advanced surge suppression with GSA Grade A–Mode1–Class1 endurance,UL1449-2andANSIC62.41compliance.TCR™technologydefeats surgesupto72,000AandprovidesexcellentEMI/RFIfiltering.ETL-Listed.  ACSPR-2009-VTE: 20Apowerpanelwith5switchedand4unswitchedoutlets (including1onfront).1Uchassis.Includes9' cordwithNEMA5-20P(20A)plug. Features advanced surge suppression with GSA Grade A–Mode1–Class1 endurance,UL1449-2andANSIC62.41compliance.TCR™technologydefeats surgesupto72,000AandprovidesexcellentEMI/RFIfiltering.Alsofeatures VoltageToleranceEnvelope™(VTE)—over/undercircuitrywithautoresetthat turnsallreceptaclesoffwhenlinevoltageexceeds140Vordropsbelow100V. Followingavoltagetoleranceshutdown,unitautomaticallyrestorespowerto receptacleswhenitdetectsacceptablelinevoltage.Ifpowerisinterruptedwhile VTEisactivated,switchedoutletsdefaulttoOFF.ETL-Listed. Model No. Description ACR-1509 ACSPR-1509 ACSPR-1509-VTE U181RL U181RL-LC ACR-2009 ACSPR-2009 ACSPR-2009-VTE 15A 15A 15A 15A 15A 20A 20A 20A AC Power Panel AC Power Panel with advanced surge suppression AC Power Panel with advanced surge suppression & VTE AC Power Panel with lamp AC Power Panel with lamp & longer cord AC Power Panel AC Power Panel with advanced surge suppression AC Power Panel with advanced surge suppression & VTE Rack Units Carton Pack Carton Wt. lb. (kg) 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 10 (4.5) 11 (5) 11 (5) 5 (2.5) 5 (2.5) 10 (4.5) 11 (5) 11 (5) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 47 Hardwired 15A: L184: 15Apowerpanel;2Ublankfrontwith4rear-mountedduplexoutlets. Pigtailleads.UL-Listed. L184-TVSS (front) L184-TVSS: 15A power panel; 2U blank front with 4 rear-mounted duplex outlets. Pigtail leads. Includes transient voltage surge suppression to meet UL1449-2.UL-Listed. back Model No. Description L184 L184-TVSS 15A AC Power Panel with pigtails 15A AC Power Panel with pigtails & surge suppression Rack Units Carton Pack Carton Wt. lb. (kg) 1 1 1 1 4 (2) 4 (2) Remote-control (contact closure) Corded 15A: RPC-4CD: 19"rackmountpanelwithremotecontrol,2Ublankpanelinfront and4(15A)duplexoutletsinback.Singlecircuit.Includes6' cord.ETL-Listed. ACSPR-RPC1-1509: 19"rackmountpanelwithremotecontrolfor6switched outletsand3unswitchedoutlets(1front,2rear).1Uchassis.Includes9' cord withNEMA5-15P(15A)plug.Remotepowercontrol(RPC)circuitryfor6outlets allowson/offswitchingbycontactclosure.Rearterminationblocksareprovided forremoteswitches,externaltriggersandanalarminterface(forusewheremandated by fire code). Includes advanced surge suppression with GSA GradeA–Mode1–Class1endurance,UL1449-2andANSIC62.41compliance. Exclusive TCR™ technology defeats surges up to 72,000A and provides excellentEMI/RFIfiltering.AlsoincludesVoltageToleranceEnvelope™(VTE)— over/undercircuitrywithautoresetthatturnsallreceptaclesoffwhenlinevoltage exceeds140Vordropsbelow100V.Followingavoltagetoleranceshutdown, unitautomaticallyrestorespowertoreceptacleswhenitdetectsacceptableline voltage.IfpowerisinterruptedwhileVTEisactivated,switchedoutletsdefault toOFF.Rockerswitchactivation.ETL-Listed. RPC-4CD ACSPR-RPC1-1509 back ACSPR-RPC1-1509K: sameasabovebutwithkeyswitchactivation. 20A: ACSPR-RPC1-2009: 19" rackmountpanelwithremotecontrolfor6switched outletsand3unswitchedoutlets(1front,2rear).1Uchassis.Includes9' cord withNEMA5-20P(20A)plug.Remotepowercontrol(RPC)circuitryfor6outlets allowson/offswitchingbycontactclosure.Rearterminationblocksareprovided forremoteswitches,externaltriggersandanalarminterface(forusewheremandatedbyfirecode).IncludesadvancedsurgesuppressionwithGSAGradeA– Mode1–Class1endurance,UL1449-2andANSIC62.41compliance.Exclusive TCR™technologydefeatssurgesupto72,000AandprovidesexcellentEMI/RFI filtering.AlsoincludesVoltageToleranceEnvelope™(VTE)—over/undercircuitry withautoresetthatturnsallreceptaclesoffwhenlinevoltageexceeds140Vor dropsbelow100V.Followingavoltagetoleranceshutdown,unitautomatically restorespowertoreceptacleswhenitdetectsacceptablelinevoltage.Ifpower isinterruptedwhileVTEisactivated,switchedoutletsdefaulttoOFF.Rocker switchactivation.ETL-Listed. front ACSPR-RPC1-2009K Key switch. back ACSPR-RPC1-2009K: sameasabovebutwithkeyswitchactivation. Model No. Description RPC-4CD ACSPR-RPC1-1509 ACSPR-RPC1-1509K ACSPR-RPC1-2009 ACSPR-RPC1-2009K 15A 15A 15A 20A 20A AC Power Panel with remote control AC Power Panel with remote control, adv. surge suppression & VTE AC Power Panel with remote control, adv. surge suppression & VTE (key switch) AC Power Panel with remote control, adv. surge suppression & VTE AC Power Panel with remote control, adv. surge suppression & VTE (key switch) Rack Units Carton Pack Carton Wt. lb. (kg) 2 1 1 1 1 1 1 1 1 1 5 (2.5) 11 (5) 11 (5) 11 (5) 11 (5) Hardwired 15A: 48 RPC-4MC: 19" rackmountpanelwithremotecontrol,2Ublankpanelinfrontand 4 (15A) duplex outlets in back. Single circuit. Includes 6' metal clad whip. ETL-Listed. Model No. Description RPC-4MC 15A AC Power Panel with remote control & whip RPC-4MC Rack Units Carton Pack Carton Wt. lb. (kg) 2 1 6 (3) Sequencing & Remote-control Corded 15A: ACR-SCS4-1509: 19" rackmountpanelwithremotecontrol,alarminterface and4-stepsequentialpower.Features6switchedand3unswitchedoutlets (9totalincluding1onfront).1Uchassis.Includes9' cordwithNEMA5-15P(15A) ACR-SCS4-1509 plug.Rearterminationblocksareprovidedforremoteswitchesandanalarm systeminterface(forusewheremandatedbyfirecode).Rockerswitchactivation. ETL-listed. ACR-SCS4-1509K: sameasabovebutwithkeyswitchactivation. ACSPR-SCS4-1509: 19" rackmountpanelwithremotecontrol,alarminterface and4-stepsequentialpower.Features6switchedand3unswitchedoutlets (9totalincluding1onfront).1Uchassis.Includes9' cordwithNEMA5-15P(15A) ACR-SCS4-1509K plug.Rearterminationblocksareprovidedforremoteswitchesandanalarm systeminterface(forusewheremandatedbyfirecode).Includesadvancedsurge suppressionwithGSAGradeA–Mode1–Class1endurance,UL1449-2andANSI C62.41compliance.ExclusiveTCR™technologydefeatssurgesupto72,000A andprovidesexcellentEMI/RFIfiltering.Rockerswitchactivation. ETL-listed. Key switch. ACSPR-SCS4-1509K: sameasabovebutwithkeyswitchactivation. 20A: ACR-SCS4-2009-RT2: 19" rackmountpanelwithremotecontrol,alarminterfaceand4-stepsequentialpower.Features6switchedand3unswitchedoutlets (9totalincluding1onfront).1Uchassis.Includes9' cordwithNEMA5-20P(20A) plug.Rearterminationblocksareprovidedforremoteswitches,externaltriggers andanalarmsysteminterface(forusewheremandatedbyfirecode).Includes 2drycontactclosures(steps5and6)fortriggeringremotepowercontrolunits (RPCseries-notincluded).Rockerswitchactivation.ETL-listed. ACSPR-SCS4-1509 ACR-SCS4-2009K-RT2: sameasabovebutwithkeyswitchactivation. ACSPR-SCS4-2009-RT2: 19" rackmount panel with remote control, alarm interfaceand4-stepsequentialpower.Features6switchedand3unswitched outlets(9totalincluding1onfront).1Uchassis.Includes9' cordwithNEMA5- ACR-SCS4-2009-RT2 20P (20A) plug. Rear termination blocks are provided for remote switches, externaltriggersandanalarmsysteminterface(forusewheremandatedbyfire code).Includes2drycontactclosures(steps5and6)fortriggeringremote powercontrolunits(RPCseries-notincluded).Alsofeaturesadvancedsurge suppressionwithGSAGradeA–Mode1–Class1endurance,UL1449-2andANSI C62.41compliance.ExclusiveTCR™technologydefeatssurgesupto72,000A andprovidesexcellentEMI/RFIfiltering.Rockerswitchactivation.ETL-listed. ACSPR-SCS4-2009K-RT2: sameasabovebutwithkeyswitchactivation. Model No. Description ACR-SCS4-1509 ACR-SCS4-1509K ACSPR-SCS4-1509 ACSPR-SCS4-1509K ACR-SCS4-2009-RT2 ACR-SCS4-2009K-RT2 ACSPR-SCS4-2009-RT2 ACSPR-SCS4-2009K-RT2 15A 15A 15A 15A 20A 20A 20A 20A Rack Units AC Power Panel with sequencing & remote control AC Power Panel with sequencing & remote control (key switch) AC Power Panel with sequencing, remote control & adv. surge suppression AC Power Panel with sequencing, remote control & adv. surge suppression (key switch) AC Power Panel with sequencing, remote control & trigger AC Power Panel with sequencing, remote control & trigger (key switch) AC Power Panel with sequencing, remote control, adv. surge suppression & trigger AC Power Panel with sequencing, remote control, adv. surge suppression & trigger (key sw) 1 1 1 1 1 1 1 1 Carton Pack Carton Wt. lb. (kg) 1 1 1 1 1 1 1 1 11 (5) 11 (5) 11 (5) 11 (5) 11 (5) 11 (5) 11 (5) 11 (5) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 49 Low Voltage Sequencers 4-STEP: SCS-4R: 19"rackmountpowerpanelwithsequencersprovidestime-delayed activation/deactivationofequipmentthat’sconnectedtoremotepowercontrols. 1Uchassisprovides4controloutputs.Eachoutputcanactivateequipment connected to a maximum of 10 remote power controls (RPC-series, not included). Each output also includes separate auxiliary relay for sequential operationofotherdevices.Includesvariabletimedelay,LEDstatusindicators, UL-Listedpowersupply,andscrewterminalinterfaceforlifesafetysystems. Rockerswitch.Note:optionalswitcheswithmomentaryclosurecanbeusedto activateremotely—orderseparately(pg.64). SCS-4RK SCS-4RK: sameasabovebutwithkeyswitchactivation. 8-STEP: SCS8R-ASM: 19"rackmountpowerpanelwithsequencersprovidestimedelayedactivation/deactivationofequipmentthat’sconnectedtoremotepower SCS8R-ASM controls.1Uchassisprovides8controloutputs.Eachoutputcanactivateequipmentconnectedtoamaximumof10remotepowercontrols(RPC-series,not included).Eachoutputalsoincludesseparateauxiliaryrelayforsequentialoperation of other devices. Includes variable time delay, LEDstatus indicators, UL-Listedpowersupply,andscrewterminalinterfaceforlifesafetysystems.In addition,unitincludesanalternatesequencemode(rearprogrammableDIP switchthatallowsusertobypassselectedoutletstosequentiallyactivateaportionofthesystem—usefulforsmallereventslikerehearsals).Rockerswitch. Note:optionalswitcheswithmomentaryormaintainedclosurecanbeusedto activateremotely—orderseparately(pg.64). back SCS8RK-ASM: sameasabovebutwithkeyswitchactivation. 50 Model No. Description SCS-4R SCS-4RK SCS8R-ASM SCS8RK-ASM Low-voltage Power Panel with 4-channel time delay Low-voltage Power Panel with 4-channel time delay (key switch) Low-voltage Power Panel with 8-channel time delay & alternate sequence mode Low-voltage Power Panel with 8-channel time delay & alternate sequence mode (key) Rack Units Carton Pack Carton Wt. lb. (kg) 1 1 1 1 1 1 1 1 9 (4) 9 (4) 10 (4.5) 10 (4.5) POWER II: AC POWER STRIPS Power Strips – Single-circuit Corded 15A NEMA:  ACS-1505-SW: compact15Apowerstripmeasuresonly12"Lx2"Hx2"D.Includesmultimountbrackets,5singleoutletsspacedforpowersupplies,on/offswitch,6' detachable IECcordwithNEMA5-15Pplug.MadeinU.S.A.ETL-Listed. ACS-MP: 1UaluminumpanelallowsACS-1505-SWpowerstriptobemountedin 19" EIAformatoninsideoroutsideofrack,oronthirdrailsetinsiderackwithoutlets facingup,downorsideways.Black.MadeinU.S.A. ACS-1506: 15Apowerstrip(20"Lx15/8"Hx13/8"D)terminatestoNEMA5-15P(15A) molded plug. Features 6 light-colored single outlets. Includes transient voltage surge suppression with LEDindicator, circuit breaker, cable ties, mounting clip/screw and 6' attachedcord.Imported.UL-Listed. ACS-1510-WW: 15Apowerstrip(30"Lx2"Hx2"D)terminatestoNEMA5-15P(15A) moldedplug.Features10whitesingleoutletswith“wall-wart”spacingsuitableforexternal powersupplies.Includes9' 10" detachablecord,circuitbreakerandmulti-mountbrackets. MadeinU.S.A.ETL-Listed. ACS-1510-WW-SW: sameasabovewithon/offswitch.  ACS-MP ACS-1512: 15Apowerstrip(32"Lx15/8"Hx13/8"D)terminatestoNEMA5-15P(15A) moldedplug.Features12light-coloredsingleoutlets.Includestransientvoltagesurge suppressionwithLEDindicator,circuitbreaker,cableties,mountingclip/screwand12' attachedcord.Imported.UL-Listed. ACS-1505-SW A variety of power strips feature multi-mount brackets that provide multiple rack-mounting options so outlets can face left, right or rack center. ACS-1524: 15Apowerstrip(60"Lx15/8"Hx13/8"D)terminatestoNEMA5-15P(15A) moldedplug.Features24light-coloredsingleoutlets.Includestransientvoltagesurge suppressionwithLEDindicator,circuitbreaker,cableties,mountingclip/screwand12' attachedcord.Imported.UL-Listed. 15A IEC:  ACS-1512-IEC: 15A power strip (30"L x 2"H x 2"D) features 12 IEC outlets and 9' 10" detachablecord.Includescircuitbreaker,multi-mountbrackets.MadeinU.S.A.ETL-Listed. ACS-1512-IEC-SW: sameasabovewithon/offswitch.  ACS-1520-IEC-SW: 15A power strip (60"L x 2"H x 2"D) features 20 IEC outlets and 9' 10" detachable cord. Includes circuit breaker, on/off switch and multi-mount brackets.MadeinU.S.A.ETL-Listed.  ACS-1524-IEC: 15A power strip (30"L x 2"H x 2"D) features 24 IEC outlets and 9' 10" detachablecord.Includescircuitbreakerandmulti-mountbrackets.MadeinU.S.A.ETL-Listed.  ACS-1530-IEC: 15A power strip (60"L x 2"H x 2"D) features 30 IEC outlets and 9' 10" detachablecord.Includescircuitbreakerandmulti-mountbrackets.MadeinU.S.A.ETL-Listed. ACS-1530-IEC-SW: sameasabovewithon/offswitch.  20A NEMA: ACS-2012: 20Apowerstrip(32"Lx15/8"Hx13/8"D)terminatestoNEMA5-20P(20A) molded plug. Features 8 (15A) and 4 (20A) outlets. Includes transient voltage surge suppressionwithLEDindicator,circuitbreaker,cableties,mountingclip/screwand12' attachedcord.Imported.UL-Listed. ACS-2024: 20Apowerstrip(70"Lx15/8"Hx13/8"D)terminatestoNEMA5-20P(20A) molded plug. Features 16 (15A) and 8 (20A) outlets. Includes transient voltage surge suppressionwithLEDindicator,circuitbreaker,cableties,mountingclip/screwand12' attachedcord.Imported.UL-Listed. Model No. Description ACS-1505-SW ACS-MP ACS-1506 ACS-1510-WW ACS-1510-WW-SW ACS-1512 ACS-1524 ACS-1512-IEC ACS-1512-IEC-SW ACS-1520-IEC-SW ACS-1524-IEC ACS-1530-IEC ACS-1530-IEC-SW ACS-2012 ACS-2024 15A Corded Power Strip, 5 single outlets & switch 1U Mounting Panel (for use with ACS-1505-SW) 15A Corded Power Strip with surge suppression, 6 single outlets 15A Corded Power Strip, 10 single outlets with wall-wart spacing 15A Corded Power Strip, 10 single outlets with wall-wart spacing & switch 15A Corded Power Strip with surge suppression, 12 single outlets 15A Corded Power Strip with surge suppression, 24 single outlets 15A Corded Power Strip, 12 IEC outlets 15A Corded Power Strip, 12 IEC outlets & switch 15A Corded Power Strip, 20 IEC outlets & switch 15A Corded Power Strip, 24 IEC outlets 15A Corded Power Strip, 30 IEC outlets 15A Corded Power Strip, 30 IEC outlets & switch 15A/20A Corded Power Strip with surge suppression, 12 single outlets 15A/20A Corded Power Strip with surge suppression, 24 single outlets ACS-1524 ACS-1510-WW-SW Carton Pack Carton Wt. lb. (kg) 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3 (1.5) 1 (.5) 3 (1.5) 7 (3) 7 (3) 5 (2.5) 10 (5) 7 (3) 7 (3) 8 (3.5) 8 (3.5) 8 (3.5) 9 (4) 5 (2.5) 11 (5.5) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). ACS-1506 51 Hardwired 15A: ACS-1513-WW-HW: 15Apowerstrip(30"Lx2"Wx2"D)includesmulti-mount brackets (to position outlets either perpendicular or parallel to side of rack), terminates to 6' non-metallic flexible conduit with pigtail leads. Features 13 single outlets with “wall-wart” spacing for external power supplies. Made in U.S.A.ETL-Listed. 20A: ACS-2014-HW: 20A power strip (30"L x 2"W x 2"D) includes multi-mount brackets (to position outlets either perpendicular or parallel to side of rack), terminates to 6' non-metallic flexible conduit with pigtail leads. Features 7 duplexoutlets.MadeinU.S.A.ETL-Listed. ACS-1513-WW-HW includes 6' non-metallic, flexible conduit. ACS-2014-IG-HW: same as above but with 7 isolated ground duplex outlets. ACS-2014-SS-HW: 20Apowerstrip(30"Lx2"Wx2"D)includesmounting brackets (to position outlets either perpendicular or parallel to side of rack, terminatesto6' non-metallicflexibleconduitwithpigtailleads.Includestransient voltagesurgesuppressionand7duplexoutlets.MadeinU.S.A.ETL-Listed. Model No. Description ACS-1513-WW-HW ACS-2014-HW ACS-2014-IG-HW ACS-2014-SS-HW 15A Hardwired Power Strip with 13 single outlets, flexible conduit 20A Hardwired Power Strip with 7 duplex outlets, flexible conduit 20A Hardwired Power Strip with 7 isolated ground duplex outlets, flexible conduit 20A Hardwired Power Strip with 7 duplex outlets, surge suppression, flexible conduit Carton Pack Carton Wt. lb. (kg) 1 1 1 1 5 (2.5) 7 (3) 8 (3.5) 8 (3.5) Power Strips – Multi-circuit Hardwired 15A: 20A: ACS-1524-2C: 15Apowerstrip(70"Lx15/8"Hx13/8"D)with2(15A)circuits andpigtailleads—blackchassiswith12whiteand12greyalternatingoutlets (1colorforeachcircuit).Symmetricaldesignallowshardwiredconnectionsto bemadefromeitherendwithoutanadditionalJ-box.Includesmountingclips andwireties.Imported.UL-Listed. ACS-2020-6C-HW includes 6' non-metallic, flexible conduit. ACS-2024-2C: 20Apowerstrip(70"Lx15/8"Hx13/8"D)with2(20A)circuits andpigtailleads—blackchassiswith12whiteand12greyalternatingoutlets (1colorforeachcircuit).Symmetricaldesignallowshardwiredconnectionsto bemadefromeitherendwithoutanadditionalJ-box.Includesmountingclips andwireties.Imported.UL-Listed. ACS-2014-2C-HW: 20Apowerstrip(30"Lx2"Wx2"D)with2(20A)circuits. Includes3duplexand8singleoutlets.Terminatesto6' non-metallicflexible conduitwithpigtailleads.Includesmulti-mountbracketsandhardware. Made inU.S.A.ETL-Listed. Many hardwired power strips feature the new 6' flexible conduit that’s easy to trim in the field. ACS-2014-IG-2C-HW: sameasabovebuthas3duplexand8single isolatedgroundoutlets. ACS-2020-6C-HW: 20Apowerstrip(60"Lx2"Wx2"D)with6(20A)circuits and10duplexoutlets.Terminatesto6' non-metallicflexibleconduitwithpigtail leads.Includesmulti-mountbracketsandhardware.MadeinU.S.A.ETL-Listed. ACS-2020-IG-6C-HW: same as above but with 10 isolated ground duplexoutlets. ACS-2020-10C-HW: 20Apowerstrip(60"Lx2"Wx2"D)with10(20A)circuits and10duplexoutlets.Terminatesto6' non-metallicflexibleconduitwithpigtail leads.Includesmulti-mountbracketsandhardware.MadeinU.S.A.ETL-Listed. ACS-2020-IG-10C-HW: same as above but with 10 isolated ground duplexoutlets. Model No. Description ACS-1524-2C 15A Hardwired Power Strip with 2-circuits, 24 single outlets ACS-2024-2C 20A Hardwired Power Strip with 2-circuits, 24 single outlets ACS-2014-2C-HW 20A Hardwired Power Strip with 2-circuits, 3 duplex & 8 single outlets ACS-2014-IG-2C-HW 20A Hardwired Power Strip with 2-circuits, 3 duplex & 8 single isolated ground outlets ACS-2020-6C-HW 20A Hardwired Power Strip with 6-circuits, 10 duplex outlets ACS-2020-IG-6C-HW 20A Hardwired Power Strip with 6-circuits, 10 isolated ground duplex outlets ACS-2020-10C-HW 20A Hardwired Power Strip with 10-circuits, 10 duplex outlets ACS-2020-IG-10C-HW 20A Hardwired Power Strip with 10-circuits, 10 isolated ground duplex outlets 52 Carton Pack Carton Wt. lb. (kg) 1 1 1 1 1 1 1 1 11 (5.5) 11 (5.5) 8 (3.5) 11 (5.5) 11 (5.5) 12 (5.5) 13 (6) 14 (6.5) Power Strips – Remote Control (single-circuit) Corded 15A: ACS-1510-RPC: 15Averticalpowerstrip(30"Lx2"Wx2"D)withlowvoltage remotecontrol.Features5duplexoutlets(4switched,1unswitched)andmultimount brackets. Includes 9' 10" detachable cord, mounting brackets and hardware.MadeinU.S.A.ETL-Listed. Model No. Description ACS-1510-RPC 15A Corded Vertical Power Strip with remote control, 5 duplex outlets Carton Pack 1 Carton Wt. lb. (kg) 6 (3) Hardwired 20A: ACS-2010-RPC-HW: 20Averticalpowerstrip(30”Lx2”Wx2”D)withlowvoltage remotecontrolfeatures5duplexoutlets(4switched,1unswitched)andmulti-mount brackets.Includes6' non-metallicflexibleconduit.MadeinU.S.A.ETL-Listed. ACS-2010-IG-RPC-HW: sameasabovebutwith5IGduplexoutlets. Carton Pack Model No. Description ACS-2010-RPC-HW ACS-2010-IG-RPC-HW 20A Hardwired Vertical Power Strip with remote control, 5 duplex outlets, flex-conduit 1 20A Hardwired Vertical Power Strip with remote control, 5 IG duplex outlets, flex-conduit 1 Carton Wt. lb. (kg) 7 (3) 7 (3) Power Strips – Remote Control (multi-circuit) Hardwired 20A: ACS-2018-5C-RPC-HW: 20Averticalpowerstrip(60"Lx2"Wx2"D)with4 switched circuits and 1 unswitched circuit and low voltage remote control featuresatotalof18outlets(2duplexoutletsperswitchedcircuitand1duplex outletontheunswitchedcircuit).Includes6' non-metallicflexibleconduit,multimountbracketsandhardware.MadeintheU.S.A.ETL-Listed. ACS-2018-IG-5C-RPC-HW: sameasabovebutwith18IGoutlets. Model No. Description Carton Pack ACS-2018-5C-RPC-HW 20A Hardwired Vertical Power Strip with remote control, 5-circuits, 9 duplex outlets 1 ACS-2018-IG-5C-RPC-HW 20A Hardwired Vertical Power Strip with remote control, 5-circuits, 9 IG duplex outlets 1 Carton Wt. lb. (kg) 12 (5.5) 13 (6) Power Strips – 240VAC 50/60 Hz Corded 10A: ACSE-1012: 10Averticalpowerstrip(30"Lx2"Wx2"D)with12IECtypeC13outlets. PowerinletIECtypeC14.Cordprovidedwithoutattachmentplug.MadeinU.S.A. ETL-Listed.ListedtoEN60065:2002,A1,A11,C1CEapprovedfortheEU. ACSE-1012-SW: sameasabovebutwithswitch. ACSE-1015-SW: 10Averticalpowerstrip(30"Lx2"Wx2"D)with15IECtypeC13 outletsandswitch.PowerinletIECtypeC14.Cordprovidedwithoutattachment plug. Made in U.S.A. ETL-Listed. Listed to EN 60065:2002, A1, A11, C1 CE approvedfortheEU. ACSE-1018: 10Averticalpowerstrip(30"Lx2"Wx2"D)with18IECtypeC13outlets. PowerinletIECtypeC14.Cordprovidedwithoutattachmentplug.MadeinU.S.A. ETL-Listed.ListedtoEN60065:2002,A1,A11,C1CEapprovedfortheEU. ACSE-1020-SW: 10Averticalpowerstrip(30"Lx2"Wx2"D)with20IECtypeC13 outletsandswitch.PowerinletIECtypeC14.Cordprovidedwithoutattachment plug. Made in U.S.A. ETL-Listed. Listed to EN 60065:2002, A1, A11, C1 CE approvedfortheEU. ACSE-1024: 10Averticalpowerstrip(30"Lx2"Wx2"D)with24IECtypeC13outlets. PowerinletIECtypeC14.Cordprovidedwithoutattachmentplug.MadeinU.S.A. ETL-Listed.ListedtoEN60065:2002,A1,A11,C1CEapprovedfortheEU. Model No. Description ACSE-1012 ACSE-1012-SW ACSE-1015-SW ACSE-1018 ACSE-1020-SW ACSE-1024 10A Corded Vertical Power Strip, 12 IEC outlets 10A Corded Vertical Power Strip, 12 IEC outlets, switch 10A Corded Vertical Power Strip, 15 IEC outlets, switch 10A Corded Vertical Power Strip, 18 IEC outlets 10A Corded Vertical Power Strip, 20 IEC outlets, switch 10A Corded Vertical Power Strip, 24 IEC outlets Carton Pack 1 1 1 1 1 1 Carton Wt. lb. (kg) 5 (2.5) 5 (2.5) 7 (3) 7 (3) 10 (4.5) 10 (4.5) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 53 POWER III: MODULAR POWER STRIPS Save time and labor – order the POWERSTAC™ pre-mounted in a ganging or enclosed rack & have it shipped directly to the job site.† MODULAR: ThePOWERSTAC™modularpowersystemlet’syoucustomdesignapower striptoaccommodatespecificneedsofalmostanyapplication.Blankmodules allowroomforfutureexpansion.Savetimeinthefieldbyorderingagangingor enclosedrackwithapre-mountedPOWERSTAC.† Full Component Library: J-boxesforinternalorexternalrackmount,chassis lengthsupto75",singleormulti-circuitpowermodules(15A,20A,30A,remotecontrolandsurgesuppressionoptions,newIECoutlets). Field-Changeable Modules: thepatentedrotatingoutletdesign(USpatent D535178S) allows individual power modules to be repositioned in the field withoutremovingtheentirepowerstripfromtherack. New Flexible-conduit Option: 6' non-metallicflexibleconduit. New “SIG” Option: the default grounding scheme for configurations with isolated ground circuits is a common IG conductor. You can also order an independentconductorforeachcircuitbyaddingthe“SIG”suffixtotheendof thecustommodelnumber(additionalchargesapply).Note:therearelimitations tothenumberofcircuitsthatwillfitintoasingleunit.Whenthe“SIG”optionis selectedwiththe6' flexible-conduitconfiguration,thedefaultconduitsizeis1.25". Easy to Design: threebasicsteps:selectthecomponents(chassis/J-boxor chassis/flexible-conduitcombination,individualpowermodules),createacustom partnumber,andindicatewherethestripistobemountedintherack(additional worksheetsareavailableonlineatwww.lowellmfg.com). 1). Power Layout: selectchassislengthandJ-box(or6' non-metallic flexibleconduit)accordingtorackheightandpositionofoutlets.The J-boxcanbepositionedinsideoroutsidetherack.† Locatechassis/ J-boxorchassis/flexible-conduitI.D.(singlecharacterfor75",two charactersfor60",threecharactersfor30")andrecordnumberintop box.Thenselectindividualpowermodules(seepg.56fordescriptions) and record module I.D. numbers in order desired, placing one characterineachboxasshownbelow. 2). Custom Part No.: transfermodulenumbers(inorder)tocreatethe custompartnumber.Fillallboxes,addingblankmodulestofillgaps. IftheSIGoptionisdesired,add“SIG”asasuffixoutsidetheboxes. 3). Rackmount Position: indicate rackmount position. If none is indicated,defaultpostionwillbeusedforpositioningoutlets. † 54 Change your mind? Change‘em around! Individual power modules can be reoriented in the field without removing the entire strip from the rack. For shipping integrity on external J-box configurations, the J-box and mounting hardware will be packed in a carton that’s placed inside the rack. POWERSTACs ordered without a rack will incur additional packaging charges. POWERSTAC™ Module Library PartnumbersshownonthispageareforuseindesigningacompletePOWERSTAC™thatistobeassembledatourplantandshippedasa completeunit.Moduledescriptionsareonpage56.Topurchaseindividual(replacement)modules,usethepartnumbersonpg.57. J-boxandflexibleconduitdescriptions withallowablewire combinations. SIGOption: 6' flexibleconduit withallowablewire combinations. I.D.numbersfor chassis/J-boxcombo or chassis/flexibleconduitcombo. Chassis with J-box on rack EXTERIOR: I.D. JB1plus30-inchchassis: JB1plus60-inchchassis: JB1plus75-inchchassis: JB2plus30-inchchassis: JB2plus60-inchchassis: JB2plus75-inchchassis: JB3plus30-inchchassis: JB3plus60-inchchassis: JB3plus75-inchchassis: JB4plus30-inchchassis: JB4plus60-inchchassis: JB4plus75-inchchassis: JB5plus30-inchchassis: JB5plus60-inchchassis: JB5plus75-inchchassis: Y11 X1 K Y22 X2 N Y33 X3 P — X4 Q — — R Chassis with J-box on rack INTERIOR: I.D. JB1plus30-inchchassis: JB1plus60-inchchassis: JB1plus75-inchchassis: JB2plus30-inchchassis: JB2plus60-inchchassis: JB2plus75-inchchassis: JB3plus30-inchchassis: JB3plus60-inchchassis: JB3plus75-inchchassis: JB4plus30-inchchassis: JB4plus60-inchchassis: JB4plus75-inchchassis: JB5plus30-inchchassis: JB5plus60-inchchassis: JB5plus75-inchchassis: Y44 X5 T Y55 X6 W Y66 X7 — — X8 — — — — Chassis with flexible-conduit: I.D. 6' conduitattopof30" chassis 6' conduitatbottomof30" chassis 6' conduitattopof60" chassis 6' conduitatbottomof60" chassis 6' conduitattopof75" chassis 6' conduitatbottomof75" chassis Y77 Y88 X9 X0 H J PowerModuleI.D.(descriptionsonnextpage). 1 2 3 4 5 6 7 8 9 B1 B2 B3 B4 B5 B6 B7 B8 B9 C11 C12 C13 C14 C15 C16 C17 C18 C19 G BA C20 (multi-circuit) BB C21 BC C22 BD C23 BJ C24 C25 Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). C30 BE BF BG BH C26 C27 C28 C29 55 POWERSTAC™ Modules Thesemodelnumbersareusedwhendesigningandorderingacomplete,pre-assembledPOWERSTAC™.Additionalchargesapplyforthe “SIG”optionandforpackaging/shippingunitswithoutarack. 56 Part No. Description POWER MODULES: 5" module: Blank 1 2 5" module: DUPLEX (1) 15A (NEMA 5-15R) 3 5" module: SINGLE (2) 15A (NEMA 5-15R) 4 5" module: DUPLEX (1) 20A (NEMA 5-20R) 5" module: DUPLEX (1) 20A Isolated Ground (NEMA 5-20R) 5 5" module: TWISTLOCK (1) 30A (NEMA L5-30R) 6 5" module: TWISTLOCK (1) 30A Isolated Ground (NEMA L5-30R) 7 5" module: SINGLE (1) 20A (NEMA 5-20R) 8 9 5" module: SINGLE (1) 20A Isolated Ground (NEMA 5-20R) G 5" module: IEC-C13 (4) 15A B1 10" module: Blank 10" module: DUPLEX (3) 15A (NEMA 5-15R) B2 10" module: SINGLE (4) 15A (NEMA 5-15R) B3 10" module: DUPLEX (2) 20A (NEMA 5-20R) B4 B5 10" module: DUPLEX (2) 20A Isolated Ground (NEMA 5-20R) B6 10" module: TWISTLOCK (1) 30A (NEMA L5-30R) B7 10" module: TWISTLOCK (1) 30A Isolated Ground (NEMA L5-30R) B8 10" module: DUPLEX (1) 20A (NEMA 5-20R) with remote control 10" module: DUPLEX (1) 20A Isolated Ground (NEMA 5-20R) with remote control B9 10" module: TWISTLOCK (1) 30A (NEMA L5-30R) with remote control BA 10" module: TWISTLOCK (1) 30A Isolated Ground (NEMA L5-30R) with remote control BB BC 10" module: DUPLEX (1) 20A (NEMA 5-20R) with surge suppressor BD 10" module: DUPLEX (1) 20A Isolated Ground (NEMA 5-20R) with surge suppressor BE 10" module: DUPLEX (2) 20A (NEMA 5-20R) 2 circuits, 1 duplex each BF 10" module: DUPLEX (2) 20A Isolated Ground (NEMA 5-20R) 2 circuits, 1 duplex each 10" module: TWISTLOCK (2) 30A (NEMA L5-30R) 2 circuits, 1 outlet each BG 10" module: TWISTLOCK (2) 30A Isolated Ground (NEMA L5-30R) 2 circuits, 1 outlet each BH 10" module: IEC-C13 (8) 15A BJ C11 15" module: Blank C12 15" module: DUPLEX (4) 15A (NEMA 5-15R) C13 15" module: SINGLE (6) 15A (NEMA 5-15R) C14 15" module: DUPLEX (3) 20A (NEMA 5-20R) C15 15" module: DUPLEX (3) 20A Isolated Ground (NEMA 5-20R) C16 15" module: TWISTLOCK (1) 30A (NEMA L5-30R) C17 15" module: TWISTLOCK (1) 30A Isolated Ground (NEMA L5-30R) C18 15" module: DUPLEX (2) 20A (NEMA 5-20R) with remote control C19 15" module: DUPLEX (2) 20A Isolated Ground (NEMA 5-20R) with remote control C20 15" module: TWISTLOCK (1) 30A (NEMA L5-30R) with remote control C21 15" module: TWISTLOCK (1) 30A Isolated Ground (NEMA L5-30R) with remote control C22 15" module: DUPLEX (2) 20A (NEMA 5-20R) with surge suppressor C23 15" module: DUPLEX (2) 20A Isolated Ground (NEMA 5-20R) with surge suppressor C24 15" module: DUPLEX (1) 20A (NEMA 5-20R) with surge suppressor & remote control C25 15" module: DUPLEX (1) 20A Isolated Ground (NEMA 5-20R) with surge suppressor & remote control C26 15" module: DUPLEX (3) 20A (NEMA 5-20R) 3 circuits, 1 duplex each C27 15" module: DUPLEX (3) 20A Isolated Ground (NEMA 5-20R) 3 circuits, 1 duplex each C28 15" module: TWISTLOCK (3) 30A (NEMA L5-30R) 3 circuits, 1 outlet each C29 15" module: TWISTLOCK (3) 30A Isolated Ground (NEMA L5-30R) 3 circuits, 1 outlet each C30 15" module: IEC-C13 (12) 15A I.D. FOR CHASSIS / J-BOX COMBINATION: Y11 30" 3-circuit chassis with J-box-1 mounted to rack exterior X1 60" 3-circuit chassis with J-box-1 mounted to rack exterior K 75" 3-circuit chassis with J-box-1 mounted to rack exterior Y22 30" 4-circuit chassis with J-box-2 mounted to rack exterior X2 60" 4-circuit chassis with J-box-2 mounted to rack exterior N 75" 4-circuit chassis with J-box-2 mounted to rack exterior Y33 30" 6-circuit chassis with J-box-3 mounted to rack exterior X3 60" 6-circuit chassis with J-box-3 mounted to rack exterior P 75" 6-circuit chassis with J-box-3 mounted to rack exterior X4 60" 12-circuit chassis with J-box-4 mounted to rack exterior Q 75" 12-circuit chassis with J-box-4 mounted to rack exterior R 75" 15-circuit chassis with J-box-5 mounted to rack exterior Y44 30" 3-circuit chassis with J-box-1 mounted to rack interior X5 60" 3-circuit chassis with J-box-1 mounted to rack interior T 75" 3-circuit chassis with J-box-1 mounted to rack interior Y55 30" 4-circuit chassis with J-box-2 mounted to rack interior X6 60" 4-circuit chassis with J-box-2 mounted to rack interior W 75" 4-circuit chassis with J-box-2 mounted to rack interior Y66 30" 6-circuit chassis with J-box-3 mounted to rack interior X7 60" 6-circuit chassis with J-box-3 mounted to rack interior X8 60" 12-circuit chassis with J-box-4 mounted to rack interior I.D. FOR CHASSIS / FLEXIBLE-CONDUIT COMBINATION: Y77 30" 6-circuit chassis with 6' non-metallic flexible conduit (top) Y88 30" 6-circuit chassis with 6' non-metallic flexible conduit (bottom) X9 60" 12-circuit chassis with 6' non-metallic flexible conduit (top) X0 60" 12-circuit chassis with 6' non-metallic flexible conduit (bottom) H 75" 15-circuit chassis with 6' non-metallic flexible conduit (top) J 75" 15-circuit chassis with 6' non-metallic flexible conduit (bottom) Unit 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Module Wt. lb. (kg) 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1.5 (.75) 1.5 (.75) 1.5 (.75) 1.5 (.75) 1.5 (.75) 1.5 (.75) 1.5 (.75) 1.5 (.75) 1.5 (.75) 1.5 (.75) 1.5 (.75) 1.5 (.75) 1.5 (.75) 1.5 (.75) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 2.5 (1) 2 (1) 2 (1) 2 (1) Chassis Wt. 7 (3) 10 (4.5) 13 (6) 8 (3.5) 11 (5) 14 (6.5) 8 (3.5) 11 (5) 14 (6.5) 12 (5.5) 15 (7) 15 (7) 7 (3) 10 (4.5) 13 (6) 8 (3.5) 11 (5) 14 (6.5) 8 (3.5) 11 (5) 12 (5.5) 1 1 1 1 1 1 6 (3) 6 (3) 9 (4) 9 (4) 12 (5.5) 12 (5.5) POWERSTAC™ Individual Replacement Modules TheACM-seriesofmodelnumbersshownbelowcorrespondtothePOWERSTAC™modulespicturedonpg.55butwithan“ACM”prefixadded to indicate the module will be sold individually (not as part of a preassembled unit). This option allows customers to purchase replacement componentsfortheirPOWERSTAC™ortoassembleacompleteunitinthefield(limitedtooptionslistedbelow).Individualpowermoduleswiththe ACMprefixincludeagroundjumpcableandwireleads. Part No. Description Carton Pack Carton Wt. lb. (kg) INDIVIDUAL COMPONENTS: POWER MODULES 5" module: Blank ACM-1 ACM-2 5" module: DUPLEX (1) 15A (NEMA 5-15R) 5" module: SINGLE (2) 15A (NEMA 5-15R) ACM-3 ACM-4 5" module: DUPLEX (1) 20A (NEMA 5-20R) 5" module: DUPLEX (1) 20A Isolated Ground (NEMA 5-20R) ACM-5 ACM-6 5" module: TWISTLOCK (1) 30A (NEMA L5-30R) 5" module: TWISTLOCK (1) 30A Isolated Ground (NEMA L5-30R) ACM-7 ACM-8 5" module: SINGLE (1) 20A (NEMA 5-20R) ACM-9 5" module: SINGLE (1) 20A Isolated Ground (NEMA 5-20R) 5" module: IEC-C13 (4) 15A ACM-G ACM-B1 10" module: Blank 10" module: DUPLEX (3) 15A (NEMA 5-15R) ACM-B2 ACM-B3 10" module: SINGLE (4) 15A (NEMA 5-15R) 10" module: DUPLEX (2) 20A (NEMA 5-20R) ACM-B4 ACM-B5 10" module: DUPLEX (2) 20A Isolated Ground (NEMA 5-20R) ACM-B6 10" module: TWISTLOCK (1) 30A (NEMA L5-30R) ACM-B7 10" module: TWISTLOCK (1) 30A Isolated Ground (NEMA L5-30R) 10" module: DUPLEX (1) 20A (NEMA 5-20R) with remote control ACM-B8 ACM-B9 10" module: DUPLEX (1) 20A Isolated Ground (NEMA 5-20R) with remote control 10" module: TWISTLOCK (1) 30A (NEMA L5-30R) with remote control ACM-BA ACM-BB 10" module: TWISTLOCK (1) 30A Isolated Ground (NEMA L5-30R) with remote control ACM-BC 10" module: DUPLEX (1) 20A (NEMA 5-20R) with surge suppressor 10" module: DUPLEX (1) 20A Isolated Ground (NEMA 5-20R) with surge suppressor ACM-BD ACM-BE 10" module: DUPLEX (2) 20A (NEMA 5-20R) 2 circuits, 1 duplex each ACM-BF 10" module: DUPLEX (2) 20A Isolated Ground (NEMA 5-20R) 2 circuits, 1 duplex each ACM-BG 10" module: TWISTLOCK (2) 30A (NEMA L5-30R) 2 circuits, 1 receptacle each ACM-BH 10" module: TWISTLOCK (2) 30A Isolated Ground (NEMA L5-30R) 2 circuits, 1 receptacle each ACM-BJ 10" module: IEC-C13 (8) 15A 125VAC/10A 250VAC ACM-C11 15" module: Blank ACM-C12 15" module: DUPLEX (4) 15A (NEMA 5-15R) ACM-C13 15" module: SINGLE (6) 15A (NEMA 5-15R) ACM-C14 15" module: DUPLEX (3) 20A (NEMA 5-20R) ACM-C15 15" module: DUPLEX (3) 20A Isolated Ground (NEMA 5-20R) ACM-C16 15" module: TWISTLOCK (1) 30A (NEMA L5-30R) ACM-C17 15" module: TWISTLOCK (1) 30A Isolated Ground (NEMA L5-30R) ACM-C18 15" module: DUPLEX (2) 20A (NEMA 5-20R) with remote control ACM-C19 15" module: DUPLEX (2) 20A Isolated Ground (NEMA 5-20R) with remote control ACM-C20 15" module: TWISTLOCK (1) 30A (NEMA L5-30R) with remote control ACM-C21 15" module: TWISTLOCK (1) 30A Isolated Ground (NEMA L5-30R) with remote control ACM-C22 15" module: DUPLEX (2) 20A (NEMA 5-20R) with surge suppressor ACM-C23 15" module: DUPLEX (2) 20A Isolated Ground (NEMA 5-20R) with surge suppressor ACM-C24 15" module: DUPLEX (1) 20A (NEMA 5-20R) with surge suppressor & remote control ACM-C25 15" module: DUPLEX (1) 20A Isolated Ground (NEMA 5-20R) with surge suppressor & remote control ACM-C26 15" module: DUPLEX (3) 20A (NEMA 5-20R) 3 circuits, 1 duplex each ACM-C27 15" module: DUPLEX (3) 20A Isolated Ground (NEMA 5-20R) 3 circuits, 1 duplex each ACM-C28 15" module: TWISTLOCK (3) 30A (NEMA L5-30R) 3 circuits, 1 outlet each ACM-C29 15" module: TWISTLOCK (3) 30A Isolated Ground (NEMA L5-30R) 3 circuits, 1 outlet each ACM-C30 15" module: IEC-C13 (12) 15A 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 (.5) 2 (1) 2 (1) 2 (1) 2 (1) 2 (1) 3 (1.5) 2 (1) 2 (1) 2 (1) 1.5 (.75) 3 (1.5) 3 (1.5) 3 (1.5) 3 (1.5) 3 (1.5) 4 (2) 3 (1.5) 3 (1.5) 4 (2) 4 (2) 3 (1.5) 3 (1.5) 3 (1.5) 3 (1.5) 4 (2) 4 (2) 3 (1.5) 2 (1) 3 (1.5) 3 (1.5) 3 (1.5) 3 (1.5) 3 (1.5) 4 (2) 3 (1.5) 3 (1.5) 4 (2) 4 (2) 3 (1.5) 3 (1.5) 4 (2) 3 (1.5) 4 (2) 5 (2.5) 5 (2.5) 6 (3) 3 (1.5) INDIVIDUAL COMPONENTS: CHASSIS with NON-METALLIC FLEXIBLE CONDUIT ACM-30WP 30" chassis with 6' x 0.75" non-metallic flexible conduit for ACM-series replacement modules ACM-60WP 60" chassis with 6' x 1.00" non-metallic flexible conduit for ACM-series replacement modules ACM-75WP 75" chassis with 6' x 1.25" non-metallic flexible conduit for ACM-series replacement modules 1 1 1 6 (3) 9 (4) 12 (5.5) INDIVIDUAL COMPONENTS: J-BOX ACM-JBEX4 External J-box kit with bracket and hardware 12-20A ACM-JBEX5 External J-box kit with bracket and hardware 15-20A 1 1 3 (1.5) 4 (2) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 57 POWER IV: ADVANCED SURGE SUPPRESSION Rackmount Seepages47-49. COMPAC™ Corded 15A: ACSP-1502-RPC: high-performance, low-profile (9"L x 6"W x 1.75"H) 15A surgesuppressorwithremote-controlmountsundercounters,inracksoron shelveswithversatilemulti-mountbrackets(included).Alsoincludesadetachable IECcordandNEMA5-15Pplug.Featuresadvancedsurgesuppressionwith GSA GradeA–Mode1–Class1 endurance, UL1449-2 and ANSI C62.41 compliance. Suppresses line to neutral without ground contamination. Proprietary TCR™ technology defeats surges up to 72,000A and provides excellentEMI/RFIfiltering.Includes2outletswithpatented(#D535178S)rotating platesthatturn90˚forfrontorsideaccess.10-yearwarranty.ETL-Listed. ACSP-1502-VTE: same as above but instead of the remote control it featuresVTE™over/underprotection. 20A: COMPAC™ (ACSP-2002-RPC) 20A surge suppressor includes remote power control, attached cord and multi-mount brackets for mounting versaility (15A models have a detachable cord). ACSP-2002-RPC: high-performance, low-profile (9"L x 6"W x 1.75"H) 20A surgesuppressorwithremote-controlmountsundercounters,inracksorona shelfwithversatilemulti-mountbrackets(included).IncludesanattachedIEC cordandNEMA5-20Pplug.FeaturesadvancedsurgesuppressionwithGSA GradeA–Mode1–Class1endurance,UL1449-2andANSIC62.41compliance. Suppresseslinetoneutralwithoutgroundcontamination.ProprietaryTCR™ technologydefeatssurgesupto72,000AandprovidesexcellentEMI/RFIfiltering. Includes2outletswithpatented(#D535178S)rotatingplatesthatturn90˚for frontorsideaccess.10-yearwarranty.ETL-Listed. ACSP-2002-VTE: same as above but instead of the remote control it featuresVTE™over/underprotection. Model No. Description ACSP-1502-RPC ACSP-1502-VTE ACSP-2002-RPC ACSP-2002-VTE 15A COMPAC™ advanced surge suppression with remote control 15A COMPAC™ advanced surge suppression with VTE™ over/under protection 20A COMPAC™ advanced surge suppression with remote control 20A COMPAC™ advanced surge suppression with VTE™ over/under protection Carton Pack Carton Wt. lb. (kg) 1 1 1 1 5 (2.5) 5 (2.5) 5 (2.5) 5 (2.5) COMPAC™ STIC Corded 58 15A: ACSPS-1502: low-profile(12"Lx2"Wx2"H)15Astickmountsbehindflat screens, under counters, in racks or on shelves using versatile multi-mount brackets (included). Includes detachable IEC cord and NEMA 5-15P plug. Features advanced surge suppression with GSA GradeA–Mode1–Class1 endurance,UL1449-2andANSIC62.41compliance.Suppresseslinetoneutral withoutgroundcontamination.ProprietaryTCR™technologydefeatssurgesup to72,000AandprovidesexcellentEMI/RFIfiltering.Includes2singleoutlets. 10-yearwarranty.ETL-Listed. OPTIONS: Mounting Panel (ACS-MP): 1UaluminumpanelallowsCOMPAC-STICtobe mountedin19"EIAformatoninsideoroutsideofrack,oronthirdrailsetinside rackwithoutletsfacingup,downorsideways.IdealforusewithLVR,LCR,LLR andLPTR-seriesrackswherespacemaybelimited.Black.MadeinU.S.A. Model No. Description ACSPS-1502 ACS-MP 15A COMPAC™STIC surge suppressor Mounting Panel IU The COMPAC™-STIC includes multi-mount brackets and detachable cord. ACS-MP Carton Pack Carton Wt. lb. (kg) 1 1 5 (2.5) 1 (.5) Ground Transient Filter (GTF) Hardwired AC-GTF20-IG: ETL-recognizedfilteringdevice(for15Aor20Acircuits)tobe addedtopowerconditioninginstallations.Kitincludesslim-profileGTFfilter, 2isolatedgroundduplexoutletsandwirenuts.Installsinserieswithgroundwire (inisolatedcircuits)toprotectequipmentfromhigh-frequencygroundtransients causedbygroundfaults,atmosphericconditionsorotherdischargesonthe ground.PerNECrequirements,theGTFfilterdoesnotimpede60Hzfaultcurrent. Canbeusedasakitinconjunctionwithsurgesuppressorsorfactoryinstalled (seeGTFmodelsbelowandonnextpage). 20A: Note regarding grounding and bonding of electrical or electronic systems: Lowellstronglyrecommendscompliancewithallapplicablesectionsof theNationalElectricalCode(NEC)andlocalbuildingcodes.Insituationswhere the grounding and bonding system is less than ideal and upgrading the groundingsystemisnotpossible,Lowell’sgroundtransientfiltermayprovide isolationfromnoiseandinterferencethat’sneededtoensureproper,reliableperformanceofsystemcomponents. Model No. Description AC-GTF20-IG 20A Ground Transient Filter Kit with 2 isolated ground duplex outlets AC-GTF20-IG Carton Pack Carton Wt. lb. (kg) 1 3 (1.5) Stand-alone ACSP-2004-IG Hardwired Single-circuit: ACSP-2004: 20A1-circuitsurgesuppressor(7"Wx8"Hx3"D)forrack,wallor above-grade (plenum) installation. Meets GSA GradeA–Mode1–Class1 endurance(UL1449-2adjunct).ANSIC62.41compliant.Suppresseslineto neutralwithoutgroundcontamination.ProprietaryTCR™technologydefeats surgesupto72,000AandprovidesexcellentEMI/RFIfiltering.FeaturesLED statusindicatorsonfrontandknockoutsonallsides.Includes2duplexoutlets withpatented(USpatentno.D535178S)rotatingplatesthatturn90˚forfrontor sideaccess,and2blankplatesforNEMA1hardwireapplications.UL-Listed. 10-yearwarranty.Limited quantities. ACSP-2004-IG shown with 1 outlet rotated to side. ACSP-2004-IG: 20A1-circuitsurgesuppressor(7"Wx8"Hx3"D)forrack,wall or above-grade (plenum) installation. Meets GSA GradeA–Mode1–Class1 endurance(UL1449-2adjunct).ANSIC62.41compliant.Suppresseslineto neutralwithoutgroundcontamination.ProprietaryTCR™technologydefeats surgesupto72,000AandprovidesexcellentEMI/RFIfiltering.FeaturesLED statusindicatorsonfrontandknockoutsonallsides.Includes2isolatedground duplexoutletswithpatented(USpatentno.D535178S)rotatingplatesthatturn 90˚forfrontorsideaccess,and2blankplatesforNEMA1hardwireapplications. UL-Listed.10-yearwarranty.Limited quantities. ACSP-2004-IG-GTF: 20A1-circuitsurgesuppressor(7"Wx8"Hx3"D)forrack, wallorabove-grade(plenum)installation.MeetsGSAGradeA–Mode1–Class1 endurance(UL1449-2adjunct).ANSIC62.41compliant.Suppresseslineto neutralwithoutgroundcontamination.ProprietaryTCR™technologydefeats surgesupto72,000AandprovidesexcellentEMI/RFIfiltering.FeaturesLED statusindicatorsonfrontandknockoutsonallsides.Includes2isolatedground duplexoutletswithpatented(USpatentno.D535178S)rotatingplatesthatturn 90˚forfrontorsideaccess,and2blankplatesforNEMA1hardwireapplications. Alsoincludesgroundtransientfilter(GTF).ETL-Listed.10-yearwarranty.Limited quantities. Model No. • ACSP-2004 • ACSP-2004-IG • ACSP-2004-IG-GTF Description 20A single-circuit surge suppressor, 2 duplex outlets 20A single-circuit surge suppressor, 2 IG duplex outlets 20A single-circuit surge suppressor, 2 IG duplex outlets, GTF ACSP-2004-IG-GTF Carton Pack Carton Wt. lb. (kg) 1 1 1 5 (2.5) 5 (2.5) 6 (3) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 59 Hardwired (con’t.) Multi-circuit: ACSP20-2C: 20A2-circuitsurgesuppressorbox(14"Wx14.5"Hx4"D)with screw terminal outputs, knockouts on all sides and a cover plate that’s punchedtoexpose(3)LEDsforcircuitstatusindicationwithoutopeningthe box.Foruseasstand-alonesurgesuppressororinconjunctionwithanAC loadcentertoprovidesurgeprotectiontospecificcircuits.Morethan1unit canbeconnectedtoasingleloadcenterforlargeinstallations.Unitscanalso be used with Lowell’s sequence-controlled AC loadcenters. Meets GSA GradeA–Mode1–Class1endurance(UL1449-2adjunct).Suppresseslineto neutralwithoutgroundcontamination.ProprietaryTCR™technologydefeats surges up to 72,000A and provides excellent EMI/RFI filtering. 10-year warranty.ANSIC62.41compliant.ETL-Listed. ACSP20-6C ACSP20-3C: sameasabovebutwith3circuits. ACSP20-4C: sameasabovebutwith4circuits. ACSP20-5C: sameasabovebutwith5circuits. ACSP20-6C: sameasabovebutwith6circuits. ACSP20-2C-GTF: 20A2-circuitsurgesuppressorbox(14"Wx14.5"Hx4"D) withscrewterminaloutputs,knockoutsonallsidesandacoverplatethat’s punchedtoexpose(3)LEDsforcircuitstatusindicationwithoutopeningthe box.Foruseasstand-alonesurgesuppressororinconjunctionwithanAC loadcentertoprovidesurgeprotectiontospecificcircuits.Morethan1unit canbeconnectedtoasingleloadcenterforlargeinstallations.Unitscanalso be used with Lowell’s sequence-controlled AC loadcenters. Meets GSA GradeA–Mode1–Class1endurance(UL1449-2adjunct).Suppresseslineto neutralwithoutgroundcontamination.ProprietaryTCR™technologydefeats surgesupto72,000AandprovidesexcellentEMI/RFIfiltering.Eachcircuit alsoincludesgroundtransientfilter(GTF). 10-yearwarranty.ANSIC62.41 compliant.ETL-Listed. ACSP20-3C-GTF ACSP20-3C-GTF: sameasabovebutwith3circuits. ACSP20-4C-GTF: sameasabovebutwith4circuits. ACSP20-5C-GTF: sameasabovebutwith5circuits. ACSP20-6C-GTF: sameasabovebutwith6circuits. Replacement Modules: ACSP20M: 20Asurgesuppressionreplacement(oradd-on)moduleforuse withmodelsACSP20-2C,ACSP20-3C,ACSP20-4C,ACSP20-5CorACSP206C.Doesnotincludebox. ACSP20M-GTF ACSP20M-GTF: 20Asurgesuppressionreplacement(oradd-on)modulewith groundtransientfilter(GTF)forusewithmodels:ACSP20-2C-GTF,ACSP203C-GTF,ACSP20-4C-GTF,ACSP20-5C-GTF,orACSP20-6C-GTF.Doesnot includebox. 60 Model No. Description ACSP20-2C ACSP20-3C ACSP20-4C ACSP20-5C ACSP20-6C ACSP20M ACSP20-2C-GTF ACSP20-3C-GTF ACSP20-4C-GTF ACSP20-5C-GTF ACSP20-6C-GTF ACSP20M-GTF 20A Hardwired Surge Suppressor, 2-circuits, 2 duplex outlets 20A Hardwired Surge Suppressor, 3-circuits, 2 duplex outlets 20A Hardwired Surge Suppressor, 4-circuits, 2 duplex outlets 20A Hardwired Surge Suppressor, 5-circuits, 2 duplex outlets 20A Hardwired Surge Suppressor, 6-circuits, 2 duplex outlets 20A Hardwired Surge Suppression Module (no box), 1-circuit 20A Hardwired Surge Suppressor, 2-circuits, 2 duplex outlets & GTF 20A Hardwired Surge Suppressor, 3-circuits, 2 duplex outlets & GTF 20A Hardwired Surge Suppressor, 4-circuits, 2 duplex outlets & GTF 20A Hardwired Surge Suppressor, 5-circuits, 2 duplex outlets & GTF 20A Hardwired Surge Suppressor, 6-circuits, 2 duplex outlets & GTF 20A Hardwired Surge Suppression Module (no box), 1-circuit & GTF Carton Pack Carton Wt. lb. (kg) 1 1 1 1 1 1 1 1 1 1 1 1 13 (6) 14 (6.5) 14 (6.5) 15 (7) 15 (7) 4 (2) 15 (7) 17 (7.5) 18 (8) 20 (9) 21 (9.5) 5 (2.5) POWER V: LOADCENTERS Loadcenter with Sequence Controller Single-phase ACLC-100-20-SC248ASM: 1-phase,100A,20-space,20-circuitloadcenter with 8-step sequencer provides one-switch control of circuit breakers for sequentialACpowerdistributiontosystemcomponents.Sequencecontroller provides time-delayed activation/deactivation of connected equipment and controls up to 24-circuits with 8-steps (3-circuits per step). Sequencer has alternatesequencemode(ASM)toprovidetwooptions:fullsystem(standard) orpartialsystem(ASM)tobypassselectoutputs(idealforsmalleventslikerehearsals).Interfacestolifesafetyalarmsystem.Installationexamplescanbe viewedonlineatLowellmfg.com. 100A: ACLC-100-20-SC248ASM System includes: Cutler Hammer (1-phase, 100A, 20-space, 20-circuit) loadcenter,alternatesequencemodecontroller(ACSC-248-ASM),2remote switches, 1 remote ASM switch, LEDstatus display module (Decora-style), controltransformer,snap-inbushingsandwireties.UL-Listed. ACLC-200-30-SC248ASM: sameasabovebut1-phase,200A,30-space, 40-circuitloadcenter. 200A: Model No. Description ACLC-100-20-SC248ASM ACLC-200-30-SC248ASM AC Loadcenter System (1-phase, 100A, 20-space, 20-circuit) with ASM AC Loadcenter System (1-phase, 200A, 30-space, 40-circuit) with ASM Carton Pack Carton Wt. lb. (kg) 1 1 36 (16.5) 48 (22) Carton Pack Carton Wt. lb. (kg) 1 1 46 (21) 53 (24) Three-phase ACLC-3P-125-30-SC248ASM: 3-phase, 125A, 30-space, 42-circuit loadcenterwith8-stepsequencecontrollerprovidesone-switchcontrolofcircuit breakersforsequentialACpowerdistributiontosystemcomponents.Sequence controllerprovidestime-delayedactivation/deactivationofconnectedequipment andcontrolsupto24-circuitswith8-steps(3-circuitsperstep).Sequencerhas alternatesequencemode(ASM)toprovidetwooptions:fullsystem(standard) or partial system (ASM) to bypass select outputs (ideal for small events like rehearsals).Interfacestolifesafetyalarmsystem.Installationexamplescanbe viewedonlineatLowellmfg.com. 125A: System includes: Cutler Hammer loadcenter (3-phase, 125A, 30-space, 42-circuit) alternate sequence mode controller (ACSC-248-ASM), 2 remote switches, 1 remote ASM switch, LEDstatus display module (Decora-style), controltransformer,snap-inbushingsandwireties.UL-Listed. ACLC-3P-225-42-SC248ASM: sameasabovebut3-phase,225A,42-space, 42-circuitloadcenter. 225A: Model No. Description ACLC-3P-125-30-SC248ASM ACLC-3P-225-42-SC248ASM AC Loadcenter System (3-phase, 125A, 30-space, 42-circuit) with ASM AC Loadcenter System (3-phase, 225A, 42-space, 42-circuit) with ASM Sequence Controller (only) 24-circuit 8-STEP: ACSC-248-ASM: 8-step sequence controller provides time-delayed activation/deactivationofequipmentconnectedtoloadcentercircuits.Controls upto24circuitswith8-steps(3-circuitsperstep).Low-voltagecontactclosure allowssystemtointerfacewithhead-endcontrolsystems.Featuresalternate sequencemode(ASM)providingtwooptions:fullsystem(standard)orpartial system(ASM)tobypassselectoutputsandactivatepartofthesystem(idealfor smalleventslikerehearsals).Maybeinstalleddirectlytoloadcenterorataremote location.UL-Listed.Note:Thissequencerisincludedwiththeloadcentersystems listedabove.Orderthisunitifanadditionalsequencerisneeded. Model No. Description ACSC-248-ASM Sequence Controller with ASM for AC loadcenter (8-step, 24-circuit) The ACSC-248-ASM sequence controller can be purchased separately or as part of a loadcenter system (above). Carton Pack Carton Wt. lb. (kg) 1 13 (6) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 61 Circuit Breakers Controlled 20A: ACRB-20-1: 20A1-poleremotebreakerwithcontrolcablethatplugsinto sequencer. ACRB-20-2: 20A2-poleremotebreakerwithcontrolcablethatplugsinto sequencer. 30A: ACRB-30-1: 30A1-poleremotebreakerwithcontrolcablethatplugsintosequencer. ACRB-30-2: 30A2-poleremotebreakerwithcontrolcablethatplugsinto sequencer. Model No. Description ACRB-20-1 ACRB-20-2 ACRB-30-1 ACRB-30-2 Remote Breaker 20A circuit, 1-pole, pulse solenoid Remote Breaker 20A circuit, 2-pole, pulse solenoid Remote Breaker 30A circuit, 1-pole, pulse solenoid Remote Breaker 30A circuit, 2-pole, pulse solenoid ACRB-20-1 Carton Pack 1 1 1 1 ACRB-20-2 Carton Wt. lb. (kg) 1 (.5) 2 (1) 1 (.5) 2 (1) Standard 20A: ACB-20-1: 20Astandard(stab-mount)breaker,1-pole. ACB-20-1 62 Model No. Description ACB-20-1 Standard Breaker 20A circuit, 1-pole Carton Pack Carton Wt. lb. (kg) 1 1 (.5) POWER VI: SURFACE-MOUNT DEVICES Remote-Controls – for use with sequencers or remote switches (pg. 50, 63-64). Corded 15A: RPC-1: 15Anon-rackmount,remotepowercontrol(7.5"Lx3.25"Wx1.75"H) with1duplexoutlet.6' cord.ETL-Listed. RPC-3N1: 15Anon-rackmountremotepowercontrol(16"Lx3"Wx2.5"H)with circuitbreakerand4duplexoutlets(3-switched,1-unswitched).Includespower supply,relays,3individuallycontrolledduplexoutlets,1“alwayshot”duplex outlet, barrier strip connections, and a 24 VDC output for powering remote indicators.6' cord. 20A: RPC-1-20A-CD: 20Anon-rackmountremotepowercontrol(7.5"Lx3.25"Wx 2.75"H)with1duplexoutlet.Terminatesto6' cord.ETL-Listed. RPC-1 with 6' cord. RPC-1-TVSS-CD includes 6'. cord. RPC-1-TVSS-CD: 20Anon-rackmountremotepowercontrol(7.5"Lx3.25"W x2.75"H)withtransientvoltagesurgesuppressorand1duplexoutlet.6' cord. ETL-Listed. Model No. Description RPC-1 RPC-3N1 RPC-1-20A-CD RPC-1-TVSS-CD 15A Corded Remote Power Control, 1 duplex outlet 15A Corded Remote Power Control, 4 duplex outlets 20A Corded Remote Power Control, 1 duplex outlet 20A Corded Remote Power Control with surge suppression, 1 duplex outlet RPC-3N1 includes 6' cord. Carton Pack Carton Wt. lb. (kg) 1 1 1 1 2 (1) 4 (2) 2 (1) 2 (1) Hardwired 20A: RPC-1-20A-MC: 20Anon-rackmountremotepowercontrol(7.5"Lx3.25"Wx 2.75"H)with1duplexoutlet.6' metalcladwhip.ETL-Listed. RPC-1-IG-MC: 20Anon-rackmountremotepowercontrol(7.5"Lx3.25"Wx 2.75"H)with1isolatedgroundduplexoutlet.6' metalcladwhip.ETL-Listed. RPC-1-TVSS-MC: 20Anon-rackmountremotepowercontrol(7.5"Lx3.25"W x2.75"H)withtransientvoltagesurgesuppressorand1isolatedgroundduplex outlet.6' metalcladwhip.ETL-Listed. 30A: RPC-1-30A-MC: 30Anon-rackmountremotepowercontrol(7.5"Lx3.25"Wx 2.75"H)with1twistlockoutlet.6' metalcladwhip.ETL-Listed. Model No. Description RPC-1-20A-MC RPC-1-30A-MC RPC-1-IG-MC RPC-1-TVSS-MC 20A Hardwired Remote Power Control, 1 duplex outlet 30A Hardwired Remote Power Control, 1 twistlock outlet 20A Hardwired Remote Power Control, 1 isolated ground duplex outlet 20A Hardwired Remote Power Control with surge suppression, 1 duplex outlet RPC-1-30A-MC with 6' metal-clad whip. RPC-1-20A-MC includes 6' metal-clad whip. Carton Pack Carton Wt. lb. (kg) 1 1 1 1 4 (2) 4 (2) 4 (2) 4 (2) Sequencers Low Voltage 4-STEP: 8-STEP: SCS-4:4-output,non-rackmount,chassis-stylesequencer(7"L x3.25"Wx 1.5"H) provides time-delayed activation/deactivation of equipment that’s connected to RPC-series power controls. Each output activates equipment connectedtoamaximumof10remotepowercontrols.FeaturesLEDstatus indicatorandUL-Listedpowersupply.Switchwithmaintainedclosureisused toactivatesequencer(pg.64,orderseparately).MSMswitchneededwhen sequencerisusedwithmultipleswitches(pg.64,orderseparately). SCS-4 SCS-8: sameasabovebutchassis(10"Lx3.25"Wx1.5"H)has8-outputsand unitiscompatiblewithmaintainedormomentaryremoteswitches(noexternal MSMneeded). Model No. Description SCS-4 SCS-8 Low-voltage Sequencer (4-output) Low-voltage Sequencer (8-output) SCS-8 Carton Pack Carton Wt. lb. (kg) 1 1 3 (1.5) 3 (1.5) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 63 POWER VII: SWITCHES Rackmount Switches Maintained Closure 1 LED: RPSB-R: low-voltage,rockerswitchinsteelEIApanel(19"Wx1U)activates equipmentthat’sconnectedtoaremotepowercontrol.Single-pole,single-throw (SPST)switchfeaturesmaintainedclosureforsingle-switchapplications.Includes 1LEDstatusindicator(requires3-conductorwire)andrearconnectiontermination strips.TypicallyusedwithRPC-series(stand-alone)orSCS-4(pg.63). RPSB-R Rocker switch RPSB-KR: sameasabovebutwithkeyswitch. Model No. Description RPSB-R RPSB-KR 1U Rackmount Switch, 1-LED (maintained closure) rocker switch 1U Rackmount Switch, 1-LED (maintained closure) key switch Carton Pack Carton Wt. lb. (kg) 1 1 1 (.5) 1 (.5) Momentary Closure 1 LED: RPSB-MR: low-voltage,rockerswitchinsteelEIApanel(19"Wx1U)activates equipmentthat’sconnectedtoaremotepowercontrol.Single-pole,single-throw (SPST)switchfeaturesMOMENTARYclosureforapplicationswheremultiple switchesareusedtoactivateequipment.Includes1LEDstatusindicatorand rearconnectionterminationstrips.TypicallyusedwithSCS-8(pg.63),SCS-4R (pg.50)orMSM(below). RPSB-MR RPSB-MKR: sameasabovebutwithkeyswitch. 2 LED: RPSB2-MR: low-voltage,rockerswitchinsteelEIApanel(19"Wx1U)activates equipmentthat’sconnectedtoaremotepowercontrol.Single-pole,single-throw (SPST)switchfeaturesMOMENTARYclosureforapplicationswheremultiple switchesareusedtoactivateequipment.Includes2LEDstatusindicatorsand rearconnectionterminationstrips(requires4-conductorwire).Typicallyusedwith SCS8R-ASM,SCS8RK-ASM(pg.50)orloadcentersequencers(pg.61). RPSB2-MR RPSB2-MKR: sameasabovebutwithkeyswitch. Model No. Description RPSB-MR RPSB-MKR RPSB2-MR RPSB2-MKR 1U Rackmount Switch, 1-LED (momentary closure) rocker switch 1U Rackmount Switch, 1-LED (momentary closure) key switch 1U Rackmount Switch, 2-LED (momentary closure) rocker switch 1U Rackmount Switch, 2-LED (momentary closure) key switch Carton Pack Carton Wt. lb. (kg) 1 1 1 1 1 (.5) 1 (.5) 1 (.5) 1 (.5) Momentary Switch Module Surface-mount MSM: low-voltageswitchmodule(forRPCandSCS-4)designedtoconverta maintained switch closure (required in RPC controls) to a MOMENTARY CLOSUREfunction,allowingmultipleswitchlocations.Note:sequencermodel SCS-4requiresthismodule ifused withmultipleswitches.Othersequencer modelsalreadyincludeamomentaryclosurefunction. Model No. Description MSM Momentary Closure Switch Module MSM Carton Pack Carton Wt. lb. (kg) 1 1 (.5) Replacement Key HARDWARE: 64 RPSW-KEY: replacementkeysforRPSB-KandRPSW-Kmodels.1-pr. Model No. Description Carton Pack Carton Wt. lb. (kg) RPSW-KEY Replacement Key (for RPSB-K and RPSW-K series) 1-pr 1 (.5) Wall Plate Switches Maintained Closure 1 LED: Typically used with RPC-series (stand-alone) or SCS-4 (pg. 63). RPSB-P: low-voltageDecora-style(1-gang)wallplateactivatesequipmentthat’sconnectedtoa remotepowercontrol.Switchfeaturesmaintainedclosureforsingle-switchapplications.Includes1 LEDstatusindicator(requires3-conductorwire)andrearconnectionterminationstrips.SinglePole SingleThrow(SPST).Rockerswitch.Blackplateandsubplate. RPSW-P: sameasabovebutwhiteplateandsubplate. RPSB-KP: low-voltageDecora-style(1-gang)wallplateactivatesequipmentthat’sconnectedto aremotepowercontrol.Switchfeaturesmaintainedclosureforsingle-switchapplications.Includes 1LEDstatusindicator(requires3-conductorwire)andrearconnectionterminationstrips.Single PoleSingleThrow(SPST).Keyswitch.Blackplateandsubplate. RPSW-KP: sameasabovebutwhiteplateandsubplate. RPSW-P Rocker switch RPSB-KP-ASM: low-voltageDecora-style(1-gang)wallplateONLYforusewithsequencers thatincludethealternatesequencemode(ASM)option.Includes1LEDstatusindicator(requires 3-conductorwire)andrearconnectionterminationstrips.SinglePoleSingleThrow(SPST).Key switch.Blackplateandsubplate. RPSW-KP-ASM: sameasabovebutwhiteplateandsubplate. Model No. Description RPSB-P RPSW-P RPSB-KP RPSW-KP RPSB-KP-ASM RPSW-KP-ASM Black Decora-style Wall Plate Switch 1-LED (maintained closure) rocker switch White Decora-style Wall Plate Switch 1-LED (maintained closure) rocker switch Black Decora-style Wall Plate Switch 1-LED (maintained closure) key switch White Decora-style Wall Plate Switch 1-LED (maintained closure) key switch Black Decora-style Wall Plate Switch 1-LED (maintained closure) key switch & ASM White Decora-style Wall Plate Switch 1-LED (maintained closure) key switch & ASM RPSW-KP-ASM Key switch Carton Pack Carton Wt. lb. (kg) 1 1 1 1 1 1 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) Momentary Closure 1 LED: Typically used with SCS-8 (pg. 63), SCS-4R (pg. 50) or MSM (pg. 64). RPSB-MP: low-voltageDecora-style(1-gang)wallplateactivatesequipmentthat’sconnectedto a remote power control. Switch features MOMENTARY closure for applications where multiple switchesareusedtoactivateequipment.Includes1LEDstatusindicator(requires3-conductorwire) andrearconnectionterminationstrips.SinglePoleSingleThrow(SPST).Rockerswitch.Blackplate andsubplate. RPSW-MP: sameasabovebutwhiteplateandsubplate. RPSB-MKP: low-voltageDecora-style(1-gang)wallplate,activatesequipmentthat’sconnected toaremotepowercontrol.SwitchfeaturesMOMENTARYclosureforapplicationswheremultiple switchesareusedtoactivateequipment.Includes1LEDstatusindicator(requires3-conductorwire) andrearconnectionterminationstrips.SinglePoleSingleThrow(SPST).Keyswitch.Blackplate andsubplate. RPSW-MKP sameasabovebutwhiteplateandsubplate. 2 LED: RPSW2-MP Typically used with SCS8R-ASM, SCS8RK-ASM (pg. 50) or loadcenter sequencers (pg. 61). RPSB2-MP: low-voltageDecora-style(1-gang)wallplateactivatesequipmentthat’sconnectedto a remote power control. Switch features MOMENTARY closure for applications where multiple switchesareusedtoactivateequipment.Includes2LEDstatusindicators(requires4-conductor wire)andrearconnectionterminationstrips.SinglePoleSingleThrow(SPST).Rockerswitch.Black plateandsubplate. RPSW2-MP sameasabovebutwhiteplateandsubplate. RPSW2-MKP RPSB2-MKP: low-voltageDecora-style(1-gang)wallplateactivatesequipmentthat’sconnected toaremotepowercontrol.SwitchfeaturesMOMENTARYclosureforapplicationswheremultiple switchesareusedtoactivateequipment.Includes2LEDstatusindicators(requires4-conductor wire)andrearconnectionterminationstrips.SinglePoleSingleThrow(SPST).Keyswitch.Black plate and subplate. Typically used with SCS8R-ASM, SCS8RK-ASM (pg. 50) or loadcenter sequencers(pg.61). RPSW2-MKP sameasabovebutwhiteplateandsubplate. Model No. Description RPSB-MP RPSW-MP RPSB-MKP RPSW-MKP RPSB2-MP RPSW2-MP RPSB2-MKP RPSW2-MKP Black Decora-style Wall Plate Switch 1-LED (momentary closure) rocker switch White Decora-style Wall Plate Switch 1-LED (momentary closure) rocker switch Black Decora-style Wall Plate Switch 1-LED (momentary closure) key switch White Decora-style Wall Plate Switch 1-LED (momentary closure) key switch Black Decora-style Wall Plate Switch 2-LED (momentary closure) rocker switch White Decora-style Wall Plate Switch 2-LED (momentary closure) rocker switch Black Decora-style Wall Plate Switch 2-LED (momentary closure) key switch White Decora-style Wall Plate Switch 2-LED (momentary closure) key switch RPSB2-MKP Carton Pack Carton Wt. lb. (kg) 1 1 1 1 1 1 1 1 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) 1 (.5) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 rack unit = 1.75" (44.45mm). 65 AUDIO I: PACKAGED SPEAKER SYSTEMS Open Architecture or Recessed Ceiling iMount®-series: pro-sound 12" SPEAKER: TheiMount® professional,packagedspeakersystemisengineeredfor flownorbolt-ininstallationinopenceilingorclosedgridlay-intileceilings. Ready-to-install,thesystemincludesaspeaker,grilleandrectangularenclosurewithpre-mounted1/4–20forgedeyeboltsforsecureflowninstallation.Somemodelsincludeatransformer.Thesystemshipswithasteel coverplateoverthespeakerforjobsiteprotectionduringinstallation. Performance: professionalquality,high-performancesoundforentertainmentvenues,conventioncenters,hotels,restaurants,retail sites, educational facilities, arenas, airport terminals, exhibit halls, clubsandhouseofworshipapplications. Forged eyebolts 3-cu.ft. Speaker: twooptions: 12P150: 150Wcoaxialspeakerwithhighfrequencycompression driver,38oz.LFand7.7oz.HFmagnets. 12Q250: 250Wcoaxialspeakerwithhighfrequencycompression driver,77oz.LFand42oz.HFmagnets.  Black or white grille Transformer: somemodelsalsoincludeatransformer(seetable below).TheAudioVision™transformer’sfullfrequencyresponseand highpowerhandlingallowsthedrivertooperateatfullpotentialwhile providingastableloadtotheamplifier.Fronttapselectionsarecoveredbythegrille.Twooptions: TLS3270: tapselectionsat8,16,32W(70V) TLS10070: tapselectionsat16,32,64,100W(70V) 12-inch speakers Enclosure/Grille: 3-cu.ft.,rectangular,steelenclosurewithfieldchangeableeyeboltsandaccessibleconnections(broughtto4"x4" coverplateontop).Eyeboltscanberemovedforthreaded-rodor strut-mountapplications.Blackpowderepoxyfinish.Perforated-steel grilleinblackorwhite. 8-inch speakers 12P150 66 Featuresaresimilartothe12"iMountexcept: Speaker: twooptions: 8A50: 50Wcoaxialspeaker. 8P100: 100Wcoaxialspeakerwithhighfrequencycompression driver. Enclosure: 2-cu.ft.rectangularsteelenclosure. 8P100 8A50 Option for plenum space with limited height: 2-cu.ft. enclosure is also available (12P150 driver only). Call for model numbers and pricing. 8" SPEAKER: 12Q250 Optional transformers TLS3270 TLS10070 Carton Pack Carton Wt. lbs. 12" 150W iMount Speaker System (3-cu.ft., 12P150 speaker) black grille 12" 150W iMount Speaker System (3-cu.ft., 12P150 speaker) white grille 12" 150W iMount Speaker System (3-cu.ft., 12P150 speaker, TLS3270 xfmr) black grille 12" 150W iMount Speaker System (3-cu.ft., 12P150 speaker, TLS3270 xfmr) white grille 12" 150W iMount Speaker System (3-cu.ft., 12P150 speaker, TLS10070 xfmr) black grille 12" 150W iMount Speaker System (3-cu.ft., 12P150 speaker, TLS10070 xfmr) white grille 12" 250W iMount Speaker System (3-cu.ft., 12Q250 speaker) black grille 12" 250W iMount Speaker System (3-cu.ft., 12Q250 speaker) white grille 12" 250W iMount Speaker System (3-cu.ft., 12Q250 speaker, TLS3270 xfmr) black grille 12" 250W iMount Speaker System (3-cu.ft., 12Q250 speaker, TLS3270 xfmr) white grille 12" 250W iMount Speaker System (3-cu.ft., 12Q250 speaker, TLS10070 xfmr) black grille 12" 250W iMount Speaker System (3-cu.ft., 12Q250 speaker, TLS10070 xfmr) white grille 1 1 1 1 1 1 1 1 1 1 1 1 61 61 58 58 61 61 75 75 72 72 75 75 8" 50W iMount Speaker System (2-cu.ft., 8A50 speaker) black grille 8" 50W iMount Speaker System (2-cu.ft., 8A50 speaker) white grille 8" 50W iMount Speaker System (2-cu.ft., 8A50 speaker, TLS3270 xfmr) black grille 8" 50W iMount Speaker System (2-cu.ft., 8A50 speaker, TLS3270 xfmr) white grille 8" 100W iMount Speaker System (2-cu.ft., 8P100 speaker) black grille 8" 100W iMount Speaker System (2-cu.ft., 8P100 speaker) white grille 8" 100W iMount Speaker System (2-cu.ft., 8P100 speaker, TLS3270 xfmr) black grille 8" 100W iMount Speaker System (2-cu.ft., 8P100 speaker, TLS3270 xfmr) white grille 8" 100W iMount Speaker System (2-cu.ft., 8P100 speaker, TLS10070 xfmr) black grille 8" 100W iMount Speaker System (2-cu.ft., 8P100 speaker, TLS10070 xfmr) white grille 1 1 1 1 1 1 1 1 1 1 31 31 33 33 47 47 44 44 47 47 Model No. Description IM-12P-3SB IM-12P-3SW IM-12P-TS32-3SB IM-12P-TS32-3SW IM-12P-TS100-3SB IM-12P-TS100-3SW IM-12Q-3SB IM-12Q-3SW IM-12Q-TS32-3SB IM-12Q-TS32-3SW IM-12Q-TS100-3SB IM-12Q-TS100-3SW IM-8A-2SB IM-8A-2SW IM-8A-TS32-2SB IM-8A-TS32-2SW IM-8P-2SB IM-8P-2SW IM-8P-TS32-2SB IM-8P-TS32-2SW IM-8P-TS100-2SB IM-8P-TS100-2SW Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). MDX-series: pro-sound 12" SPEAKER:   TheMDXpackagedspeakersystemisthe“littlebrother”totheiMount.It combineshigh-performancewithextraordinaryvalue,makingitidealfor budget-sensitive, commercial applications. System includes speaker, transformer,rectangularenclosureandgrille.Shipsready-to-install. Performance: high-performancesoundforclearmusicandvoice reproduction inareaswithmedium(12-20ft.)ceilingsandmedium ambientnoiselevels.Suitableforhotel,entertainment,restaurant,retail,education,houseofworshipandsimilarvenues. Speaker: protectedwithcoverplateduringshipping/installation. Twooptions: 12E100T60: 100W 8 ohm coaxial speaker with horn-loaded tweeter,30oz.magnet. 12E100T60 with transformer: 100Wcoaxialspeakerwith60W 70Vconstant-voltagetransformer(tapselectionsat7.5,15,30, 60W—locatedonfront). Enclosure/Grille: 3-cu.ft.rectangular,steelenclosurewith1.5"thick acoustic lining, mounting tabs with provisions for 0.125" aircraft cable,andaccessibleconnectionsthatarebroughtto4"x4"cover plate.Blackbackboxwithblackorwhiteperforatedsteelgrille. Option for plenum space with limited height: 2-cu.ft. enclosure is also available. Call for model numbers and pricing. Mounting tabs 12E100T60 with transformer. Model No. Description MDX-12E-3SB MDX-12E-3SW MDX-12E-T60-3SB MDX-12E-T60-3SW MDX Speaker System (12" 100W 3-cu.ft., 12E100T60 speaker, 8 ohm) black grille MDX Speaker System (12" 100W 3-cu.ft., 12E100T60 speaker, 8 ohm) white grille MDX Speaker System (12" 100W 3-cu.ft., 12E100T60 speaker, 60W xfmr) black grille MDX Speaker System (12" 100W 3-cu.ft., 12E100T60 speaker, 60W xfmr) white grille Carton Pack Carton Wt. lbs. 1 1 1 1 52 52 52 52 Open Architecture iMount® Cylinder-series: pro-sound 12" SPEAKER: 8" SPEAKER: TheiMount® Cylinderprofessionalspeakersystemisengineeredforflowninstallations (open ceiling systems). The ready-to-install system includes a speaker,enclosureandgrille;somemodelsincludeatransformer. Performance: professional,high-performancesoundforentertainmentvenues,conventioncenters,hotels,restaurants,educationalfacilities,arenas,airportterminalsandhouseofworshipapplications. Speaker: twooptions: 12P150: 150Wcoaxialspeakerwithhighfrequencycompression driver,38oz.LFand7.7oz.HFmagnets. 12Q250: 250Wcoaxialspeakerwithhighfrequencycompression driver,77oz.LFand42oz.HFmagnets. Transformer: somemodelsincludeatransformer.TheAudioVision™transformer’sfullfrequencyresponseandhighpowerhandling allowsthespeakertooperateatfullpotentialwhileprovidingastable loadtotheamplifier.Twooptions: TLS3270: tapselectionsat8,16,32W(70V) TLS10070: tapselectionsat16,32,64,100W(70V) Enclosure/Grille: 2-cu.ft. cylindrical steel enclosure with fieldchangeableeyeboltsandaccessibleconnectionsbroughtto4"x4" coverplateontop.Eyeboltscanberemovedforthreaded-rodor strut-mountapplications.Grille/enclosureinblackorwhite.Custom colorsavailable(additionalcharge). Option for architectural appeal: 3-cu.ft. enclosure is also available. Call for model numbers and pricing. Featuresaresimilartothe12"modelexcept: Speaker: twooptions: 8A50: 50Wcoaxialspeakerwith20oz.LF,2oz.HFmagnets. 8P100: 100Wcoaxialspeakerwithhighfrequencycompression driverwith38oz.LF,7.7oz.HFmagnets. Enclosure: 1.25or2-cu.ft. 12-inch speakers 12Q250 12P150 8A50 8P100 8-inch speakers Optional transformers Model No. Description IMC-12P-2B IMC-12P-2W IMC-12P-TS32-2B IMC-12P-TS32-2W IMC-12P-TS100-2B IMC-12P-TS100-2W 12" 150W iMount Cylinder Speaker System (2-cu.ft., 12P150 speaker) black 12" 150W iMount Cylinder Speaker System (2-cu.ft., 12P150 speaker) white 12" 150W iMount Cylinder Speaker System (2-cu.ft., 12P150 speaker, TLS3270 xfmr) black 12" 150W iMount Cylinder Speaker System (2-cu.ft., 12P150 speaker, TLS3270 xfmr) white 12" 150W iMount Cylinder Speaker System (2-cu.ft., 12P150 speaker, TLS10070 xfmr) black 12" 150W iMount Cylinder Speaker System (2-cu.ft., 12P150 speaker, TLS10070 xfmr) white TLS3270 TLS10070 Carton Pack Carton Wt. lbs. 1 1 1 1 1 1 35 35 35 35 39 39 67 Carton Pack Carton Wt. lbs. 12" 250W iMount Cylinder Speaker System (2-cu.ft., 12Q250 speaker) black 12" 250W iMount Cylinder Speaker System (2-cu.ft., 12Q250 speaker) white 12" 250W iMount Cylinder Speaker System (2-cu.ft.,12Q250 speaker, TLS3270 xfmr) black 12" 250W iMount Cylinder Speaker System (2-cu.ft., 12Q250 speaker, TLS3270 xfmr) white 12" 250W iMount Cylinder Speaker System (2-cu.ft., 12Q250 speaker, TLS10070 xfmr) black 12" 250W iMount Cylinder Speaker System (2-cu.ft., 12Q250 speaker, TLS10070 xfmr) white 1 1 1 1 1 1 52 52 48 48 52 52 8" 50W iMount Cylinder Speaker System (1.25-cu.ft., 8A50 speaker) black 8" 50W iMount Cylinder Speaker System (1.25-cu.ft., 8A50 speaker) white 8" 50W iMount Cylinder Speaker System (1.25-cu.ft., 8A50 speaker, TLS3270 xfmr) black 8" 50W iMount Cylinder Speaker System (1.25-cu.ft., 8A50 speaker, TLS3270 xfmr) white 8" 100W iMount Cylinder Speaker System (2-cu.ft., 8P100 speaker) black 8" 100W iMount Cylinder Speaker System (2-cu.ft., 8P100 speaker) white 8" 100W iMount Cylinder Speaker System (2-cu.ft., 8P100 speaker, TLS3270 xfmr) black 8" 100W iMount Cylinder Speaker System (2-cu.ft., 8P100 speaker, TLS3270 xfmr) white 8" 100W iMount Cylinder Speaker System (2-cu.ft., 8P100 speaker, TLS10070 xfmr) black 8" 100W iMount Cylinder Speaker System (2-cu.ft., 8P100 speaker, TLS10070 xfmr) white 1 1 1 1 1 1 1 1 1 1 16 16 18 18 30 30 30 30 30 30 Model No. Description IMC-12Q-2B IMC-12Q-2W IMC-12Q-TS32-2B IMC-12Q-TS32-2W IMC-12Q-TS100-2B IMC-12Q-TS100-2W IMC-8A-1B IMC-8A-1W IMC-8A-TS32-1B IMC-8A-TS32-1W IMC-8P-2B IMC-8P-2W IMC-8P-TS32-2B IMC-8P-TS32-2W IMC-8P-TS100-2B IMC-8P-TS100-2W Lay-in Drop Ceiling LT-series: pro 8" SPEAKER: TheLTspeakersystemisdesignedforfastinstallationinsuspendedtile ceilings.Twosizes:1'x2'assemblyreplaceshalfofanon-tegular2'x2' tileorone-fourthofa2'x4'tile;2'x2'assemblyreplacesastandardor tegular2'x2'tile.Assemblyshipsready-to-installwithspeakerleadsthat exitthrougha0.5"Romexclampforeasyfieldconnections.Assemblyis supportedbyT-bargridand,whererequiredbycode,canalsobesecured toceilinggridwithseismicclampsorcables(notincluded).Eachsystem includesfactory-wiredspeakermountedtoa1'x2'or2'x2'subplate withgrilleandbackbox.Somemodelsincludeatransformer. 1' x 2' assembly with integral T-bar supports adjacent (cut) ceiling tile—no need for additional metal trim. **US patent no’s. 7120269, D467579, & 7643647 (B2) Performance: smooth musical sound reproduction for lounges, restaurants,lobbies,retailstoresandsimilarvenues. Installation: 1'x2'assemblyfeaturespatented**integralT-barto savetimeandlaborduringinstallation.T-baralsoprovidessupport foradjacent(cut)ceilingtile—noneedforadditionalmetaltrim. Speaker (8A50): 50Wcoaxialspeaker(20oz.LF,2oz.HFmagnets). Transformer: somemodelsincludeatransformer(1of3options): TLM870: tapselectionsat1,2,4,8W(70V) TLM1670A: tapselectionsat4,8,16W(70V) TLM3270A: tapselectionsat8,16,32W(70V) Backbox/Grille: steel0.8-cu.ft.volumebackbox(Vb)isoffsetin 2'x2'systemssoassemblycanberotatedtoaccommodateplenum obstructions.Backislinedwith1.5"thickacousticbattingforextendedlowfrequencyperformance.Fineperforationpatternonwhite steelgrilleblendswithceilingtilewhileprovidingexcellentacoustic transparency. 68 6" SPEAKER: Featuresaresimilartothe8"modelexcept: Speaker (6A40): 8ohm40Wcoaxialspeaker(10oz.LF,2oz.HF magnets). 4" SPEAKER: Featuresaresimilartothe8"modelexcept: Speaker (4A30): 8ohm30Wcoaxialspeaker(10oz.LF,2oz.HF magnets). Backbox is offset on 2' x 2' assembly to accommodate plenum obstructions. 4A30 Model No. Description LT-8A-Vb LT-8A-T870-Vb LT-8A-TM16-Vb LT-8A-TM32-Vb LT2-8A-Vb LT2-8A-T870-Vb LT2-8A-TM16-Vb LT2-8A-TM32-Vb LT-6A-Vb LT-6A-T870-Vb LT-6A-TM16-Vb LT-4A-Vb LT-4A-T870-Vb 8" 50W 1x2 LT Speaker System (8A50 speaker, 8 ohm, Vb backbox) 8" 50W 1x2 LT Speaker System (8A50 speaker, TLM870 xfmr, Vb backbox) 8" 50W 1x2 LT Speaker System (8A50 speaker, TLM1670A xfmr, Vb backbox) 8" 50W 1x2 LT Speaker System (8A50 speaker, TLM3270A xfmr, Vb backbox) 8" 50W 2x2 LT Speaker System (8A50 speaker, 8 ohm, Vb backbox) 8" 50W 2x2 LT Speaker System (8A50 speaker, TLM870 xfmr, Vb backbox) 8" 50W 2x2 LT Speaker System (8A50 speaker, TLM1670A xfmr, Vb backbox) 8" 50W 2x2 LT Speaker System (8A50 speaker, TLM3270A xfmr, Vb backbox) 6" 40W 1x2 LT Speaker System (6A40 speaker, Vb backbox) 6" 40W 1x2 LT Speaker System (6A40 speaker, TLM870 xfmr, Vb backbox) 6" 40W 1x2 LT Speaker System (6A40 speaker, TLM1670A xfmr, Vb backbox) 4" 30W 1x2 LT Speaker System (4A30 speaker, 8 ohm, Vb backbox) 4" 30W 1x2 LT Speaker System (4A30 speaker, TLM870 xfmr, Vb backbox) 6A40 TLM870 TLM1670A Carton Pack Carton Wt. lbs. 1 1 1 1 2 2 2 2 1 1 1 1 1 20 21 23 23 50 50 52 54 17 20 21 17 20 8A50 TLM3270A LT-series: music/paging 8" SPEAKER: TheLTspeakersystemisdesignedforfastinstallationinsuspendedtile ceilings.Twosizes:1'x2'assemblyreplaceshalfofanon-tegular2'x2' tileorone-fourthofa2'x4'tile;2'x2'assemblyreplacesastandardor tegular2'x2'tile.Assemblyshipsready-to-installwithspeakerleadsthat exitthrougha0.5"Romexclampforeasyfieldconnections.Assemblyis supportedbyT-bargridand,whererequiredbycode,canalsobesecured toceilinggridwithseismicclampsorcables(notincluded).Eachsystem includesfactory-wiredspeakermountedtoa1'x2'or2'x2'subplate withgrilleandbackbox.Somemodelsincludeatransformer. 1' x 2' assembly with “No backbox” option (infinite baffle). **US patent nos. 7120269, D467579, & 7643647-B2 Performance: systemswithCT830-speaker/8XD4-backboxcombinationaresuitableformusicperformanceapplications(lounges, lobbies,etc.).Systemswith805or810speaker (withorwithoutbackbox)areforcommercialpagingandbackgroundmusic. Installation: 1'x2'assemblyfeaturespatented**integralT-barto savetimeandlaborduringinstallation.T-baralsoprovidessupport foradjacent(cut)ceilingtile—noneedforadditionalmetaltrim. Speaker: threeoptions: 805: 12Wdualconespeakerwith5oz.magnet 810: 15Wdualconespeakerwith10oz.magnet CT830: 20W coaxial speaker with 10 oz. LF and  2.1 oz. HF magnets. 1' x 2' assembly with Vb backbox. 2' x 2' assembly with backbox 8XD4. Backbox is offset to accommodate plenum obstructions. Transformer: somesystemsincludeatransformer(3options): TLM572: tapselectionsat0.25,0.5,1,2,5W(70/25V) TLM870: tapselectionsat1,2,4,8W(70V) TLM1670A: tapselectionsat4,8,16W(70V) Backbox/Grille: fineperforation,whitesteelgrilleblendswithceiling tileandprovidesexcellentacoustictransparency.Threeoptions: Vb: 0.8-cu.ft.steelbackboxlinedwith1.5"acousticbattingforextendedlowfrequencyperformance. BB: 0.147-cu.ft.steelbackboxwithpolyurethanefoamdisctoreduceacousticalandmechanicalresonace. No backbox infinitebaffle. 4" SPEAKER: 805 810 CT830 JR410 Featuresaresimilartothe8"modelexcept: Performance: forcommercialpagingandbackgroundmusic. Speaker (JR410): 15Whigh-compliancespeakerwith10oz.magnet. Backbox (BB): 0.147-cu.ft.steelbackboxwithpolyurethanefoam disctoreduceacousticalandmechanicalresonance. TLM572 TLM870 TLM1670A Carton Carton Wt. Pack lbs. Model No. Description LT-805-BB LT-805-72-BB LT-810 LT-810-72 LT-810-BB LT-810-72-BB LT-830-870 LT-830-BB LT-830-870-BB LT2-810-BB LT2-810-72BB LT2-830-T870-Vb LT2-830-TM16-Vb 8" 12W 1x2 LT Speaker System (805 speaker, 8XD4 backbox) 8" 12W 1x2 LT Speaker System (805 speaker, TLM572 xfmr, 8XD4 backbox) 8" 15W 1x2 LT Speaker System (810 speaker, no backbox) 8" 15W 1x2 LT Speaker System (810 speaker, TLM572 xfmr, no backbox) 8" 15W 1x2 LT Speaker System (810 speaker, 8XD4 backbox) 8" 15W 1x2 LT Speaker System (810 speaker, TLM572 xfmr, 8XD4 backbox) 8" 20W 1x2 LT Speaker System (CT830 speaker, TLM870 xfmr, no backbox) 8" 20W 1x2 LT Speaker System (CT830 speaker, 8XD4 backbox) 8" 20W 1x2 LT Speaker System (CT830 speaker, TLM870 xfmr, 8XD4 backbox) 8" 15W 2x2 LT Speaker System (810 speaker, 8XD4 backbox) 8" 15W 2x2 LT Speaker System (810 speaker, TLM572 xfmr, 8XD4 backbox) 8" 20W 2x2 LT Speaker System (CT830 speaker, TLM870 xfmr, Vb backbox) 8" 20W 2x2 LT Speaker System (CT830 speaker, TLM1670A xfmr, Vb backbox) 2 2 2 2 2 2 2 2 2 2 2 2 2 22 24 18 20 20 24 20 20 24 36 36 54 50 LT-410-72-BB LT-410-870-BB 4" 15W 1x2 LT Speaker System (JR410 speaker, TLM572 xfmr, 8XD4 backbox) 4" 15W 1x2 LT Speaker System (JR410 speaker, TLM870 xfmr, 8XD4 backbox) 2 2 22 22 Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 69 Recessed Ceiling CN-PRO & CN-PRO-EL-series: music/paging 8" SPEAKER: Ready-to-installsystemwithspeakerpremountedtoinnerflangeofbackbox.Speakerleadsexitthrough0.5"Romexclampforeasyfieldconnections.Twostylesofbackboxareofferedtoaccommodatetile,sheetrock orplasterapplications.Systemincludesspeaker,backboxandgrille.Some modelsincludeatransformer. Performance: high-performancesystemprovidesexcellentpower handling,lowdistortionandsmoothsoundformusicandpaging. Speaker (8A50): 8"50W8ohmcoaxialspeakerwith20oz.LFand 2oz.HFmagnets. CN8A-IX10 Transformer: somemodelsincludeatransformer.Threeoptions: TLM870: tapselectionsat1,2,4,8W(70V) TLM1670A: tapselectionsat4,8,16W(70V) TLM3270A: tapselectionsat8,16,32W(70V) Backbox/Grille: non-loadbearing, contoured profile, steel grille (12.5"dia.)withfineperforationscreenandtorsionhardware,white. Steelbackbox(10"D)linedwith1.5" thickacousticbatting,black.Two options: IX810: flatmountingflangeforacoustictile(10"dia). IX810EL: mountingflangewithextendedlipforcutoutopenings insheetrockorplaster. 6" SPEAKER: Similartothe8"modelexcept: Speaker (6A40): 40Wcoaxialspeakerwith10oz.LF,2oz.HFmagnets. Backbox: 10"dia.10"Dsteelbackboxlinedwith1.5" thickacoustic batting.Black.Twomodels: IX610: flatmountingflangeforacoustictile. IX610EL: mountingflangewithextendedlipforcutoutopenings insheetrockorplaster. TILE BRIDGE: 6A40 8A50 TLM870 TLM1670A TLM3270A Flange style suits different applications. Flat flange for acoustic tile. Extended lip for sheetrock or plaster. LBS8R1: recommended for all applications to transfer weight of assemblytoceilingsupportgrid. Carton Pack Carton Wt. lbs. 8" 50W CN Pro Speaker System (8A50 speaker, 8 ohm, IX810 backbox) 8" 50W CN Pro Speaker System (8A50 speaker, TLM870 xfmr, IX810 backbox) 8" 50W CN Pro Speaker System (8A50 speaker, TLM1670A xfmr, IX810 backbox) 8" 50W CN Pro Speaker System (8A50 speaker, TLM3270A xfmr, IX810 backbox) 8" 50W CN Pro-EL Speaker System (8A50 speaker, 8 ohm, IX810EL backbox) 8" 50W CN Pro-EL Speaker System (8A50 speaker, TLM870 xfmr, IX810EL backbox) 8" 50W CN Pro-EL Speaker System (8A50 speaker, TLM1670A xfmr, IX810EL backbox) 8" 50W CN Pro-EL Speaker System (8A50 speaker, TLM3270A xfmr, IX810EL backbox) 1 1 1 1 1 1 1 1 14 15 16 17 11 12 13 13 6" 40W CN Pro Speaker System (6A40 speaker, 8 ohm, IX610 backbox) 6" 40W CN Pro Speaker System (6A40 speaker, TLM870 xfmr, IX610 backbox) 6" 40W CN Pro Speaker System (6A40 speaker, TLM1670A xfmr, IX610 backbox) 6" 40W CN Pro-EL Speaker System (6A40 speaker, 8ohm, IX610EL backbox) 6" 40W CN Pro-EL Speaker System (6A40 speaker, TLM870 xfmr, IX610EL backbox) 6" 40W CN Pro-EL Speaker System (6A40 speaker, TLM1670A xfmr, IX610EL backbox) Tile Bridge (for 6" or 8" speaker assembly) 1 1 1 1 1 1 10 12 13 15 10 11 12 17 Model No. Description CN-8A-IX10 CN-8AT870-IX10 CN-8ATM16-IX10 CN-8ATM32-IX10 CN-8A-IX10EL CN-8AT870-IX10EL CN-8ATM16-IX10EL CN-8ATM32-IX10EL CN-6A-IX10 CN-6AT870-IX10 CN-6ATM16-IX10 CN-6A-IX10EL CN-6AT870-IX10EL CN-6ATM16-IX10EL LBS8R1 RPAK-kit: music/paging 8" SPEAKER: 70 Economicalceilingspeakersystempackagedinasinglebox.Includes(2) speakers,eachwithafactory-wireddual-voltagetransformermountedto asteelgrille,(2)backboxesand(2)tilebridges. Performance: generalpurposepaginganddistributedmusicfor commercialvenues. Speaker/Transformer (810/TLM572): 15Wdual-conespeakerwith 10oz.magnetandtransformerwithtapselectionsat0.25,0.5,1,2, 5W(70/25V). Backbox/Grille (8XD4/WB8): 0.147-cu.ft., slightly tapered steel backboxwithpolyurethanefoamdisctoreduceacousticalandmechanicalresonace,black.Whitesteelgrillepremountedtospeaker. Tile Bridge (LBS8R1): transfersweightofspeakerassemblytoceilingsupportgrid.Galvanizedsteel(23.75"L)withroundopening. The RPAK includes 2 speakers with transformers and grilles, 2 backboxes and 2 tile bridges. Carton Carton Wt. Pack lbs. Model No. Description RPAK-81072 8" RPAK speaker system (2 ea: 810 driver, TLM572 xfmr, 8XD4 backbox, LBS8R1 bridge) 1 17 Surface: Wall-mount OS-series: high-fidelity indoor/outdoor music 100W: OS-100-TB or OS-100-TW: compact,all-weatherspeakerassemblyhas moldedplastichousingwithfine-meshaluminumgrilleandaluminumUstylemountingbracketwith90˚horizontal/verticalrotation.Easyinstallation featuresinclude(4conductor)Phoenixconnectionswithweather-protectiveboot,slotstoconnecttoasinglegangE.O.boxandrearswitchfor8 ohmortransformertapselection.Imported. Performance: excellentsoundreproductionat8ohmsor25V,70V, or 100V for indoor or outdoor music applications in professional, commercial,educationalorresidentialuse. Speaker/Transformer: 2-way,100Wspeakerwith6"mica-coated wooferwithrubbersurround,and1"silk-domedtweeter.Transformer tapselections:0.94,1.9,3.8,7.5W@25V;7.5,15,30W,60W@ 70V;or15,30,60W@100V. OS-series speakers are ideal for indoor/outdoor applications. Enclosure/Grille: curvedplastichousingwithweather-resistantterminalcoverand(U-style)aluminummountingbracket.Blackorwhite. Finemeshaluminumgrillematchesenclosure. 50W: OS-50-TB or OS-50-TW: similarto100Wmodelexcept: Speaker/Transformer: 2-way,50Wspeakerwith5.25"polypropylene-coatedwooferwithrubbersurround,and0.5"PEItweeter.Transformertapselections:0.23,0.47,0.94,1.9W(25V);1.9,3.8,7.5,15W (70V);or3.8,7.5,15W(100V). OPTIONS: Omni-directional bracket (OS-BRKT-B or OS-BRKT-W): provides more versatility than the U-style mounting bracket. Black or white powder-coatedsteel. Model No. Description OS-100-TB OS-100-TW OS-50-TB OS-50-TW OS-BRKT-B OS-BRKT-W 100W OS Speaker System (black) 100W OS Speaker System (white) 50W OS Speaker System (black) 50W OS Speaker System (white) Omni-directional Bracket (black) Omni-directional Bracket (white) Optional “omnidirectional” bracket adds mounting versatility. Carton Carton Wt. Pack lbs. 1 1 1 1 1 1 6 6 6 6 2 2 DSL & DSQ-series: music/paging 8" SPEAKER: DSL-810-72: easy-to-install,15Wspeakerfeaturesdual-voltagetransformer,surface-mountbackboxwithslopedfront,andgrille. Performance: pagingandbackgroundmusicforclassrooms,medicalofficesandsimilarvenues. Speaker (810): 15Wdual-conedriverwith10oz.magnet. Transformer (TLM572): dual-voltagetransformerwithtapselectionsat0.25,0.5,1,2,5W@70/25V. Backbox/Grille: surface-mount,steelbackboxwith1.5"acoustic battingonback,featuresuniversalmountingholepatternwithknockoutsfor(500-series)wire-moldtopandbottom.Perforatedsteelgrille withbevelededges.11.3"Hx11.5"Wx5.25"D(top)3"D(bottom). NetworkGreyfinish. DSQ-810-72: easy-to-install,15Wspeakerfeaturesdual-voltagetransformer,surface-mountbackboxwithsquarefront,andgrille. Performance: pagingandbackgroundmusicforclassrooms,medicalofficesandsimilarvenues. Speaker (810): 15Wdual-conedriverwith10oz.magnet. Transformer (TLM572): dual-voltagetransformerwithtapselections at0.25,0.5,1,2,5W@70/25V. Backbox/Grille: surface-mount,steelbackboxwith1.5"acoustic battingonback,featuresuniversalmountingholepatternwithknockoutsfor(500-series)wire-moldtopandbottom.Perforatedsteelgrille withbevelededges.11.3"Hx11.5"Wx4"D.NetworkGreyfinish. DSQ81072 (square front). DSL81072 (sloped front). Model No. Description DSL-810-72 DSQ-810-72 8" 15W DSL Speaker System (810 speaker, TLM572 xfmr, sloped-front box) grey 8" 15W DSL Speaker System (810 speaker, TLM572 xfmr, square-front box) grey Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). Carton Carton Wt. Pack lbs. 2 2 18 16 71 SL-series: music/paging 8" SPEAKER: Easy-to-install 15W speaker system features speaker, dual-voltage transformer,open-backandfabricgrille. Performance: paging and background music for classrooms, medicalfacilitiesandsimilarvenues. Walnut laminate finish with black fabric grille. Speaker (810): 15Wdual-conedriverwith10oz.magnet. Transformer (TLM572): dual-voltagetransformer,tapselectionsat 0.25,0.5,1,2,5W@70/25V. Baffle/Grille: surface-mountbaffle(particleboardwithwalnutlaminate)hasopen-back,slopedfrontandblackfabricgrille.10.55"Hx 9.47"Wx5.5"D(top),3.625"D(bottom).Includesrearhangerbracket withkeyholeopeningattopcenter.Optionalvolumecontrolknob. 810 TLM572 Carton Carton Wt. Pack lbs. Model No. Description SL-810-72 SL-810-72-K 8" 15W SL Speaker System (810 speaker, TLM572 xfmr, SL8W baffle) 2 8" 15W SL Speaker System (810 speaker, TLM572 xfmr, SL8W baffle, volume control knob) 2 13 13 Surface: Open Beam BC-810-72: music/paging 8" SPEAKER: TheBC(beamclamp)8"speakersystemincludesaspeaker,transformer, steelgrilleandbackboxwithclampstoattachtobeamsorgirdersinopen structureceilings. Performance: highquality,indoor/outdoormusicapplicationsfor professional,commercial,educationalorresidentialuse. Speaker (810): 15Wdual-conedriverwith10oz.magnet. Transformer (TLM572): dual-voltagetransformer,tapselectionsat 0.25,0.5,1,2,5W(70/25V).Leadsexitthrough0.5"Romexclamp foreasyfieldconnections. BC-810-72 front and back. Backbox (8XD4): includes2clamps. Grille: perforatedsteelgrille,white. Model No. Description BC-810-72 8" 15W BC Speaker System (810 speaker, TLM572 xfmr, 8XD4 box with clamps) Carton Pack Carton Wt. lbs. 4 24 Surface: Horn LH-series: paging 30W HORN: LH-30T: re-entrant,metalhornwithhigh-efficiencycompressiondriver anddual-voltage(25/70V)transformer,suitableforindoorandoutdoor applications.Systemincludeshorn,speaker,transformeranduniversal swivelmountingbracket. Performance: clearvoice andtonereproductionforpaging,public addressandsignalinginschools,warehouses,recreationalcomplexes, distributioncenters,parkingstructuresandcommercialbuildings. Driver: 30Wcompressiondriver. Transformer: high-quality,dual-voltagetransformerwithprotective coverandbuilt-instrainrelief.Tapselectionsat1.8W,3.7W,7.5W, 15.0W,30.0W(70V)or1.8W,3.7W,7.0W,15.0W(25V)– screwdriver adjustable. LH-30T Assembly: weather-resistant for indoor/outdoor use. Universal swivelmountingbracket.Easy,2-wirehookuptorearaccessscrew terminals.10"diameter(10.5"Hx10.5"D).Greyfinish. Mounting Bracket Base: (2.875"dia.)with3equallyspacedholes for1/4–20 hardware. 15W HORN: 72 LH-15T: similarfeaturestothe30Wmodelexcept: Driver: 15Wcompressiondriver. Transformer: high-quality,dual-voltagetransformerwithprotective coverandbuilt-instrainrelief.Tapselectionsat0.9W,1.8W,3.8W, 7.5W,15.0W,(70V)or0.48W,0.94W,1.8W,7.5W,15.0W(25V)– screwdriveradjustable. Assembly: 8.5"diameter(9"Hx9.25"D). Model No. Description LH-30T LH-15T 30W LH Paging Horn (30W driver, 25/70V xfmr) grey 15W LH Paging Horn (15W driver, 25/70V xfmr) grey LH-15T Carton Pack Carton Wt. lbs. 6 6 36 30 UNIHORN®: paging 8" HORN: LUH-15T: theUNIHORN® isapremiumquality,re-entranthornthat’s designedforalmostanyapplication.Itcanbeusedindoorsoroutdoors, in recessed or surface applications, and with clamp or screw-type mounts. Simple 2-wire hookup to rear-access cable clamp, dual capacitorcircuitryand105dBSPL(1W1M)makethisidealforstandard orsupervisedfire-protectivepagingandsignaling.Novisiblehardware. All-in-one package includes horn with housing and aluminum trim ring/grille.NetworkGreypowderepoxyfinish. The Unihorn (LUH-15T) includes the horn and grille with trim ring. Ratings: UL-Listed1480(5thedition)forFireProtectiveSignaling (hornandgrille).UL2043ratedwithoutabackboxforuseinair handlingspaces.MeetsNFPA72AandCaliforniaStateFireMarshallcode. Performance: clearvoice andtonereproductionforpaging,public addressandsignalinginschools,warehouses,recreationalcomplexes, distribution centers, parking structures and commercial sites. Driver: 15Wcompressiondriver. Transformer: 70/25Vtransformerwithtapselectionsat0.9,1.8, 3.8,7.5,15(70V)and0.48,0.94,1.8,7.5,15(25V).Screwdriveradjustable.Frontandrearaccessibletransformerselectorswitch. Housing: cast-aluminumhousing(lessthan4"D)withflangedfront, moisture-sealedrearcoverandcontouredaluminumtrimring(9.6" diameter). Grille: press-fitaluminumgrille(8.02"diameter). Optional vandal-resistant grille (LUH-VRG). Optional spanner head screwdriver (HRP832). Installation: unitdepthislessthan4"forlabor-savinginstallation indrywall,plaster,acoustictile,brickorconcreteblockinstallations (willfitintoa4"Dbackboxifneeded).Installsintoneworretrofit areaswithadjustableclamps(dogs)orscrews.Connectionsare madethroughrearmetalclamp. Versatility: althoughapress-fitgrilleisincluded,theUNIHORN willalsoacceptastandard8"screw-mountgrilleandbackboxif desired.Holesarepositionedtoacceptavarietyofgrillesandbackboxeson8"EIAspacingthatmayhavebeenwrittenintospecifications.SeeUNIHORN® specificationsheetformoreinformation. OPTIONS: Vandal-resistant Grille (LUH-VRG): rugged, cast-aluminum grille (8.02"diameter)withsecondarystainlesssteelbarrierscreentoprotect theUNIHORN® fromdamage.Idealfordetentionorcorrectionalfacilities, transportation terminals, manufacturing sites, schools, hospitals and distributioncenters.Includesholesandstainlesssteelspannerscrews tomountdirectlyto9.6"diametertrimring.NetworkGrey. Spanner Head Screwdriver (HRP832): for8-32spannerscrewson vandal-resistantgrille. Optional stainless steel backbox (LUH-BOX) for installations subject to extreme environments. Optional trim plate (LUH-TP) covers rough openings in recessed installations. Stainless Steel Backbox (LUH-BOX): universal(surfaceorrecessed) backboxforextremeenvironmentinstallations.Backispunchedwith universalmountingpatterntoinstallina4"(squareoroblong)1or2gangE.O.box.TheLUH-BOXincludesarear(0.375")holewithgrommet forwireaccessand4(0.875")conduitknockouts(1perside).Backbox is10.5"squarex4"D.NetworkGrey. Aluminum Trim Plate (LUH-TP): coversroughopeningsinrecessed installations(11.5"square). Tile Bridge (LUH-TBAR): distributesweightofhornassemblywhen installedinacoustictileceilings. Model No. LUH-15T LUH-VRG HRP832 LUH-BOX LUH-TP LUH-TBAR Optional tile bridge (LUH-TBAR) distributes assembly weight in acoustic tile ceilings. Carton Carton Wt. Pack lbs. Description ® 15W UNIHORN Speaker System (15W horn, grille, trim ring) Vandal-resistant Grille (for UNIHORN) Spanner Head Screwdriver Stainless Steel Backbox (for UNIHORN) Trim Plate (for UNIHORN) Tile Bridge (for UNIHORN) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 1 10 1 1 1 1 7 20 1 6 2 2 73 AUDIO II: UL 1480 GRILLE / SPEAKER / XFMR ASSEMBLIES Fire-protective Signaling ULD, ULS, & ULT-series Important: to maintain UL-Listing, speaker assembly must be used with an approved UL-Listed backbox and compatible control equipment. Order separately. 8" SPEAKER: ULD-series: providesclearsignalforindooralarmorvoicecommunicationinemergencywarningsystemsorgeneralpublicaddressinhigh-rise hotels,schools,apartmentcomplexesandsimilarvenues.Conformsto NFPAStandard72AandislistedunderUL1480(5thedition)FireProtective SignalingandUL2043forplenumuse.Includesspeaker(15Wdualvoice coil),transformer(2factory-wireddual-voltagetransformerswithDCblockingcapacitoron1input,tapsat0.25,0.5,1,2,5W@70/25V)andgrille (roundorsquaresteel,white). ULS-series: providesclearsignalforindooralarmorvoicecommunication inemergencywarningsystemsorgeneralpublicaddressinhigh-risehotels,schools,apartmentcomplexesandsimilarvenues.ConformstoNFPA Standard72AandislistedunderUL1480(5thedition)FireProtectiveSignalingandUL2043forplenumuse.Includesspeaker(15Wsinglevoice coil,dual-cone),transformer(1factory-wireddual-voltagetransformerwith DCblockingcapacitor,tapsat0.25,0.5,1,2,5W@70/25V)andgrille (roundorsquaresteel,white). BACKBOX: ULD-WB8-2T572 ULD-SG8-2T572 ULS-SG8-CT572 ULS-WB8-CT572 Approved Backboxes: for8-inchspeakerassemblywithROUNDgrille: UL-CP84: recessed, round steel backbox with extended lip for drywallorplasterapplications.11.94"dia.x4.06"D.Black. UL-XCP84-S: recessed,roundsteelbackboxwithflatlipfortileceilings.Includesflexiblestrapstosecurebackboxwhererequiredby code.10.06"dia.x4.06"D.Black. UL- CP84 UL-P68X Approved Backboxes: for8-inchspeakerassemblywithSQUAREgrille: UL-P68X: recessed,squaresteelbackbox,10"sq.x4"D.Black. UL-CB84-SG: surface-mount,squaresteelacousticbackbox,11.5" squarex4"D.White. 4" SPEAKER: BACKBOX: ULT-series: deliversexcellentsensitivityperULmeasurementstandard (2wattsat10ft.)foremergencycommunicationsinschools,apartment complexesandsimilarvenues.ConformstoNFPAStandard72Aandis listedunderUL1480(5thedition)FireProtectiveSignalingandUL2043for plenum use. Assembly includes speaker (15W high-compliance cone speaker),transformer(dual-voltagewithparallelinputleadsandDC-blockingcapacitor,tapsat0.25,0.5,1,2,5W@70/25V),andsteelgrille(round orsquare,white). UL-CB84-SG UL-XCP84-S ULT-SG4-CT572 ULT-WB4-CT572 Approved Backbox: for4-inchspeakerassemblywithROUNDgrille: UL-CP4: recessed,steelbackboxwithextendedlipfordrywallor plasterapplications.6.3"dia.x4.125"D.Black. Approved Backboxes: for4-inchspeakerassemblywithSQUAREgrille: UL-P625X: recessed,steelbackbox6.25"sq.x4"D.Black. UL-CB44: surface,steelbackbox7.125"sq.x4.375"D.White. UL-CP4 Model No. Description ULD-WB8-2T572 ULD-SG8-2T572 ULS-WB8-CT572 ULS-SG8-CT572 ULT-WB4-CT572 ULT-SG4-CT572 8" 15W ULD Fire Protective Signaling Assembly (dual voice coil speaker, 2 xfmrs, round grille) 8" 15W ULD Fire Protective Signaling Assembly (dual voice coil speaker, 2 xfmrs, square grille) 8" 15W ULS Fire Protective Signaling Assembly (single voice coil speaker, xfmr, round grille) 8" 15W ULS Fire Protective Signaling Assembly (single voice coil speaker, xfmr, square grille) 4" 15W ULT Fire Protective Signaling Assembly (speaker, xfmr, round grille) 4" 15W ULT Fire Protective Signaling Assembly (speaker, xfmr, square grille) UL-CB44 UL-P625X Carton Pack Carton Wt. lbs. 6 6 6 6 8 8 29 26 29 26 19 19 5 5 5 6 12 12 12 18 15 20 35 17 26 35 APPROVED BACKBOXES: 74 UL-CP84 UL-XCP84-S UL-P68X UL-CB84-SG UL-CP4 UL-P625X UL-CB44 Round Recessed Backbox (for 8" assembly, extended lip, black) Round Recessed Backbox (for 8" assembly, flat lip, black, with straps) Square Recessed Backbox (for 8" assembly, black) Square Surface Acoustic Backbox (for 8" assembly, white) Round Recessed Backbox (for 4" assembly, extended lip, black) Square Recessed Backbox (for 4" assembly, black) Square Surface-mount Backbox (for 4" assembly, white) General Signaling WB12-series Important: to maintain UL-Listing, speaker assembly must be used with approved UL-Listed backbox and compatible control equipment; order separately. 12" SPEAKER: WB12-12P150: for high ceiling applications that require high energy (clubs, sports bars, airport terminals, hotel ballrooms and convention centers).ListedunderUL1480GeneralSignalingandUL2043forplenum use.Includesspeaker(12P150:150Wcoaxialspeakerwithhighfrequency compressiondriver,38oz.LFand7.7oz.HFmagnets)andgrille(WB12: roundsteel,white). BACKBOX: Approved Backbox: for12-inchspeakerassemblywithROUNDgrille: ULXCP1210-TM100: recessed,round,steelbackboxlinedwith1.5" acousticbatting.14.38"dia.x10.5"D.Backboxincludesbracketwith pre-mountedtransformer(TLM10070A:tapselectionsat16,32,64, 100W@70V). WB12-12P150 ULXCP1210-TM100 Carton Carton Wt. Pack lbs. Model No. Description WB12-12P150 12" 150W General Signaling Assembly (12P150 speaker, round grille) 1 15 Round Recessed Backbox (backbox includes pre-mounted TLM10070A xfmr) 1 12 APPROVED BACKBOX: ULXCP1210-TM100 WB8 & WB4-series Important: to maintain UL-Listing, speaker assembly must be used with approved UL-Listed backbox and compatible control equipment; order separately. 8" SPEAKER: WB8-8A50-T870: highqualitymusicorpaginginmidtolarge-sizevenues(hotellobbies,restaurants,departmentstoresandsimilarapplications). Ready-to-installunitis listedunderUL1480GeneralSignalingandUL2043 forplenumuse.Assemblyincludesspeaker(8A50:50Wcoaxialspeaker with20oz.LFand2oz.HFmagnets),transformer(TLM870:tapselectionsat1,2,4,8W@70V),andgrille(WB8:roundsteel,white). BACKBOX: Approved Backbox: for8-inchspeakerassemblywithROUNDgrille: ULXCP87: recessed,steelbackboxwith1.5"thickacousticbatting. 11.94"dia.x6.69"D.Black. 4" SPEAKER: BACKBOX: WB4-series: highqualitymusicorpagingforhotels,restaurants,departmentstores,airportterminalsandsimilarvenues.ListedunderUL1480 GeneralSignalingandUL2043forplenumuse.Assemblyincludesspeaker (4A30:30Wcoaxialwithtweeter,10oz.LFand2oz.HFmagnets),transformer(TLM870:tapselectionsat1,2,4,8W@70V)andattachedround, steelgrille,white.Availablewithtwogrilleoptions: WB4-4A30-T870: assemblywithscrew-mountgrille.  WB4T-4A30-T870: assemblywithtorsion-mountgrille. ULXCP87 WB8-8A50-T870 WB4-4A30-T870 WB4T-4A30-T870 ULDX104 ULDX104T Approved Backboxes: for4-inchspeakerassemblywithROUNDgrille: UL-DX104: recessed,round,steelbackbox.6.19"dia.x6.75"D. Black.(Screw-mountforusewithassemblyWB4-4A30-T870). UL-DX104T: recessed,round,steelbackbox.6.19"dia.x6.75"D. Black.(Torsion-mountforusewithassemblyWB4T-4A30-T870). Model No. Description WB8-8A50-T870 WB4-4A30-T870 WB4T-4A30-T870 8" 50W General Signaling Assembly (8A50 speaker, TLM870 xfmr, round grille) 4" 30W General Signaling Assembly (4A30 speaker, TLM870 xfmr, round grille, screw-mount) 4" 30W General Signaling Assembly (4A30 speaker, TLM870 xfmr, round grille, torsion-mount) Carton Carton Wt. Pack lbs. 6 6 6 30 18 18 3 8 8 12 32 32 APPROVED BACKBOXES: UL-XCP87 UL-DX104 UL-DX104T Round Recessed Backbox (for 8" assembly, black) Round Recessed Backbox (for 4" assembly, screw-mount, black) Round Recessed Backbox (for 4" assembly, torsion-mount, black) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 75 AUDIO III: GRILLE / SPEAKER ASSEMBLIES ( /-) xfmr + Assembly with Round Grille C1830, R1805, R1810, RT1810, D1410 & D3410-series: 8" SPEAKER: C1830-870: wide dispersion and clear intelligibility. Includes: speaker CT830(20Wcoaxialspeakerwith10oz.LFand2.1oz.HFmagnets), transformerTLM870(tapselections1,2,4,8W@70V),andgrilleWB8 (round,steel,screw-mount,white). R1805-72: general purpose paging and distributed music. Includes: speaker805(12Wdual-conewith5oz.magnet),transformerTLM572 (tapsat0.25,0.5,1,2,5W@70/25V),andgrille(round,steel,screwmount,white). R1805-72-K: sameasabovebutwithvolumecontrolknob. R1805-72-S: sameasabovebutwithvolumecontrolscrew. R1810: generalpurposepaginganddistributedmusic.Includes: speaker C1830-870 R1805-72 R1810-72 WB8 810(8ohm15Wdualconespeakerwith10oz.magnet),andgrille WB8 (round,steel,screw-mount,white). R1810-72: general purpose paging and distributed music. Includes: speaker810(8ohm15Wdualconespeakerwith10oz.magnet),transformerTLM572(dual-voltage,tapsat0.25,0.5,1,2,5W@70/25V),and grilleWB8(round,steel,screw-mount,white). R1810-72-K: sameasabovebutwithvolumecontrolknob. R1810-72-S: sameasabovebutwithvolumecontrolscrew. RT1810-72: sameasR1810-72butwithtorsion-mountgrille. 4" SPEAKER: D1410-72 D1410-72: full fidelity sound with very wide dispersion (170˚) for clear intelligibility.Includes:speakerJR410(15Whigh-compliancespeakerwith 10oz.magnet),transformerTLM572(taps0.25,0.5,1,2,5W@70/25V), andgrilleWB4(round,steel,screw-mount,white). CN4 WB4 D3410-72: sameasabovebutwithgrilleCN4(torsion-mount). Model No. Description C1830-870 R1805-72 R1805-72-K R1805-72-S R1810 R1810-72 R1810-72-K R1810-72-S RT1810-72 D1410-72 D3410-72 8" 15W Speaker Assembly (CT830 speaker, TLM870 xfmr, WB8 grille) 8" 12W Speaker Assembly (805 speaker, TLM572 xfmr, WB8 grille) 8" 12W Speaker Assembly (805 speaker, TLM572 xfmr, WB8 grille & volume control knob) 8" 12W Speaker Assembly (805 speaker, TLM572 xfmr, WB8 grille & volume control screw) 8" 15W Speaker Assembly (810 speaker, WB8 grille) 8" 15W Speaker Assembly (810 speaker, TLM572 xfmr, WB8 grille) 8" 15W Speaker Assembly (810 speaker, TLM572 xfmr, WB8 grille & volume control knob) 8" 15W Speaker Assembly (810 speaker, TLM572 xfmr, WB8 grille & volume control screw) 8" 15W Speaker Assembly (810 speaker, TLM572 xfmr, WB-8T torsion-mount grille) 4" 15W Speaker Assembly (JR410 speaker, TLM572 xfmr, WB4 grille) 4" 15W Speaker Assembly (JR410 speaker, TLM572 xfmr, CN4 torsion-mount grille) Carton Pack Carton Wt. lbs. 6 6 4 6 6 6 4 6 6 12 12 29 24 16 24 28 28 18 28 28 22 40 Assembly with Square Grille R7810 & D6410-series: 76 8" SPEAKER: R7810-series: generalpurposepaginganddistributedmusic.Includes: speaker810(15Wdual-conewith10oz.magnet),transformerTLM572 (taps at 0.25, 0.5, 1, 2, 5W @ 70/25V), and grille SG8 (square, steel, screw-mount,white,withoptionalvolumecontrolknobincenter). 4" SPEAKER: D6410-72: fullfidelitysoundwithverywidedispersion(170˚)forclear intelligibility.Includes:speakerJR410(15Whigh-compliancewith10oz. magnet),transformerTLM572(tapsat0.25,0.5,1,2,5W@70/25V)and grilleSG4(square,steel,screw-mount,white). D6410-72 Model No. Description R7810-72 R7810-72K D6410-72 8" 15W Speaker Assembly (810 driver, TLM572 xfmr, SG8 grille) 8" 15W Speaker Assembly (810 driver, TLM572 xfmr, SG8 grille & volume control knob) 4" 15W Speaker Assembly (JR410 driver, TLM572 xfmr, SG4 grille) R7810-72 Carton Pack Carton Wt. lbs. 6 6 6 21 21 22 AUDIO IV: SOUND-MASKING Drop Ceiling: Lay-in LT-series: music/paging/sound-masking 8" SPKR (1x2): OPTIONS: TheLTpaging/maskingsystemisasingle-systemsolutionforpagingand masking.The1'x2'assemblyreplaceshalfof(non-tegular)2'x2'ceiling tile.Idealforapplicationswhereceilingtodeckspaceislimited.Includes 2speakerswithtransformers,1'x2'subplatewithgrilleandpartitioned backbox.Shipsready-to-install. Performance: pagingdriverfiresdowntoprovideclearvoicetransmission,maskingdriverfiresuptoshapebackgroundsoundlevelsfor improvedprivacy/productivityinopenenvironmentswithdropceilings. Installation: one-piecedesign,patented*integralT-barsavesinstallationtimeandlabor.T-baralsoprovidessupportforadjacent(cut) ceilingtile—noneedforadditionalmetaltrim. Speaker/Transformer: 2(15W)dual-conespeakersandtransformerTLM572(70Vleadswiredfortapsat0.25,0.5,1,2,5W). Backbox/Grille: 23.75"Lx10.5"Wx6"H,partitionedtoprovide700 cu.in.volumeforeachspeaker.Linedwith1.5"thickfiberglass.White steelgrillewithfineperforationblendswithceilingtile. *US patents 7120269, D467579, 7643647-B2, & 6950526 LT-810-SM810 The 1' x 2' assembly has a patented, integral T-bar that supports the adjacent (cut) ceiling tile—no need for additional metal trim. Volume Adjustment Control: locatedonthemaskingspeaker,adjustmentisusefulnearbleed-throughareaslikeairreturnsorlightfixtures. Twooptions: Rotary Switch (RS): transformertapselectorwithknobcontrol. Volume Control (VL): 50ohmpotentiometer,shaft-adjustcontrol. 8" SPKR (2x2): Includes (2) drivers & transformers. Replacesstandard2'x2'ceilingtile.Featuresaresimilarto1'x2'models exceptbackboxisoffsettoaccommodateplenumobstructions. Carton Carton Wt. Pack lbs. Model No. Description LT-810-SM810 LT-810-SM810-RS LT-810-SM810-VL LT2-810-SM810 LT2-810-SM810-RS LT2-810-SM810-VL 8" 15W 1x2 LT Paging/Masking Speaker System (2 speakers, 2 xfmrs, backbox, grille) 8" 15W 1x2 LT Paging/Masking Speaker System (2 speakers, 2 xfmrs, backbox, grille & RS) 8" 15W 1x2 LT Paging/Masking Speaker System (2 speakers, 2 xfmrs, backbox, grille & VL) 8" 15W 2x2 LT Paging/Masking Speaker System (2 speakers, 2 xfmrs, backbox, grille) 8" 15W 2x2 LT Paging/Masking Speaker System (2 speakers, 2 xfmrs, backbox, grille & RS) 8" 15W 2x2 LT Paging/Masking Speaker System (2 speakers, 2 xfmrs, backbox, grille & VL) 1 1 1 2 2 2 21 22 22 53 53 53 Drop Ceiling: Grid-mount SMTGM-series: sound-masking 8" SPKR (1x2): OPTIONS: 4" SPKR (1x2): SMTGM masking grid-mount speaker sits above ceiling tile, includes speaker,transformer,backboxandgrillewithoptionalvolumecontrol. Performance: maskingspeakershapesbackgroundsoundlevelsto aidconversationalprivacy/productivityinopenareaswithdropceilings. Speaker/Transformer (810/TLM572): 8"15Wdualconespeaker with10oz.magnet.Transformertapsat0.25,0.5,1,2,5W(70V). Backbox/Grille : 700cu.in.(6"H)backboxmountedtotraythat hooksover24"centersofT-bargrid,suspendsunitoverceilingtile. Ifneeded,trayassemblycanbesecuredtogridusingtechscrews (notincluded).Black. Volume Adjustment Control: locatedonthemaskingspeaker,adjustmentisusefulnearbleed-throughareaslikeairreturnsorlightfixtures. Twooptions: Rotary Switch (RS): transformertapselectorwithknobcontrol. Volume Control (VL): 50ohmpotentiometer,shaft-adjustcontrol. Similarfeaturestothe8"modelexceptithas4" 15Whigh-compliance speakerwithbroaderdispersionangleforreducedspaces. SMTGM with optional rotary switch. Model No. Description SMTGM-810 SMTGM-810-RS SMTGM-810-VL SMTGM-410 SMTGM-410-RS SMTGM-410-VL 8" 15W 1x2 SMTGM Masking Grid-mount Speaker (810 speaker, TLM572 xfmr) 8" 15W 1x2 SMTGM Masking Grid-mount Speaker (810 speaker, TLM572 xfmr, RS) 8" 15W 1x2 SMTGM Masking Grid-mount Speaker (810 speaker, TLM572 xfmr, VL) 4" 15W 1x2 SMTGM Masking Grid-mount Speaker (JR410 speaker, TLM572 xfmr) 4" 15W 1x2 SMTGM Masking Grid-mount Speaker (JR410 speaker, TLM572 xfmr, RS) 4" 15W 1x2 SMTGM Masking Grid-mount Speaker (JR410 speaker, TLM572 xfmr, VL) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). TLM572 810 JR410 Former No. Carton Pack SMLT810 SMLT810RS SMLT810VL SMLT410 SMLT410RS SMLT410VL 2 2 2 2 2 2 Carton Wt. lbs. 26 26 26 26 26 26 77 Above Ceiling SM-series: sound-masking 8" SPEAKER: Fully assembled sound masking system provides sound dispersion in above-ceilingapplications.Ready-to-installassembliescanbemounted aimingup,downorsideways.Includesfactory-wiredspeakerwith70V transformerandexternallyexposed4" strain-relievedleadsmountedina backbox with perforated grille, plus 4-ft. chain, S-hook and rigid wire hangerforkink-free,single-pointsuspension. SM-601 series (12W): includesspeaker805(8"12Wdualcone,5oz. magnet),transformerwithtapselectionsat0.25,0.5,1,2,and5W,steel backbox(325cu.in.cylinder)withperforatedgrille.Black. SM-601-70-RS SM-802 series (15W): canalsobesuspendedfromstructuraldeckfor horizontalsounddispersion.Includesspeaker810(8"15Wdualcone,10 oz.magnet),transformerwithtapselectionsat0.25,0.5,1,2,and5W, steelbackbox(671cu.in.cylinder)withperforatedgrille.Black. SM-802-70-RSBX Pre-mounted wire hanger speeds installation. SM-803 series (20W): canalsobesuspendedfromstructuraldeckfor horizontalsounddispersion.IncludesspeakerCT830(8"20Wcoaxial, 10oz.LFand2.1oz.HFmagnets),transformerwithtapselectionsat 0.25,0.5,1,2,and5W,steelbackbox(671cu.in.cylinder)withperforated grille.Black. SM-810 series (15W): includesspeaker810(8"15Wdualcone,10oz. magnet),transformerwithtapselectionsat0.25,0.5,1,2,and5W,and steelbackbox(700cu.in.square)withperforatedgrille.Black. OPTIONS: SM-803-70-RSBX SM-810 Optionsavailableinselectmodelsasindicatedintablebelow. Rotary Switch (RS): transformertapselectorwithknobcontrolforvolumeadjustment,usefulnearbleed-throughareaslikeairreturnsorlight fixtures. Grille Box (BX): electricalboxwithcoverandknockoutsifspliceboxis desired,orfor0.5"conduitforplenumareaswherecoderequiresconduit connections. 805 810 TLM572 CT830 Model No. Description SM-601-70 SM-601-70-RS SM-802-70-RS SM-802-70-BX SM-802-70-RSBX SM-803-70-RS SM-803-70-BX SM-803-70-RSBX SM-810 SM-810-RS 8" 12W SM Sound Masking Assembly (cylindrical, 805 speaker, 70V xmfr) 8" 12W SM Sound Masking Assembly (cylindrical, 805 speaker, 70V xmfr, RS) 8" 15W SM Sound Masking Assembly (cylindrical, 810 speaker, 70V xmfr, RS) 8" 15W SM Sound Masking Assembly (cylindrical, 810 speaker, 70V xmfr, BX) 8" 15W SM Sound Masking Assembly (cylindrical, 810 speaker, 70V xmfr, RS & BX) 8" 20W SM Sound Masking Assembly (cylindrical, CT830 speaker, 70V xmfr, RS) 8" 20W SM Sound Masking Assembly (cylindrical, CT830 speaker, 70V xmfr, BX) 8" 20W SM Sound Masking Assembly (cylindrical, CT830 speaker, 70V xmfr, RS & BX) 8" 15W SM Sound Masking Assembly (square, 810 speaker, 70V xmfr) 8" 15W SM Sound Masking Assembly (square, 810 speaker, 70V xmfr, RS) Carton Pack Carton Wt. lbs. 4 4 4 4 4 4 4 4 2 2 26 26 38 38 38 36 36 36 20 20 Electronics SMG-series: sound-masking generator COMPACT: SMG-1: 5"Wx6"Ldigitalpinkorwhitenoisesignalgenerator(without amplifier),withbalancedlineormiclevel(Low-Z)andhighimpedance(HiZ)outputs.Drivesexternaldevicessuchasequalizersoramplifiers.Includesbarrierstripconnections.Black. RACKMOUNT: SMG-1R: 19"Wx5"Dx1Udigitalpinkorwhitenoisesignalgenerator (withoutamplifier),withbalancedlineormiclevel(Low-Z)andhighimpedance(Hi-Z)outputs.Drivesexternaldevicessuchasequalizersoramplifiers.Includesbarrierstripconnections.Black. SMG-1 SMG-1R 78 Model No. Description SMG-1 SMG-1R Sound-masking Generator (compact) Sound-masking Generator (rackmount) Carton Carton Wt. Pack lbs. 1 1 3 5 SMGA-series: 19" rackmount sound-masking generator/amplifier SMGA-5: digital,pinknoisesignalgenerator/amplifier(70V,25V,or8ohm output)forsoundmaskingapplications.Blackpowderepoxyfinish.Includesbarrierstripconnections.1Ux9"Dchassisforsmall,stand-alone maskingormasking-paginginstallations.Canalsobeusedtoaddmaskingtoanexistingpagingsystemorzonedarea.Thebuilt-in5Wamplifier canbeusedforpaging,music,orsignalingsources.Systemcontrolsincludeoutputlevelandadjustablelowpassfilter,noiselevel,masterlevel andindividualcontrolsforbass,midandtrebletones. SMGA-5 SMGA-20: digital,pinkorwhitenoisesignalgenerator/amplifier(70V,25V, or8ohmoutput)forsoundmaskingapplications.Blackpowderepoxy finish.Includesbarrierstripconnections.2Ux9"Dchassis.Features20W amplifierwithoutputsforbalancedlineofmiclevel(Low-Z)andhighimpedanceline(Hi-Z),andleveladjustmentforauxiliaryinputsignal.Lineoutputandauxiliaryinputcanbeconfiguredtouseanexternalequalizer. Includesbass,midandtrebletonecontrols.UL-Listed. Model No. Description SMGA-5 SMGA-20 Sound-masking Generator/Amplifier (1U) Sound-masking Generator/Amplifier (2U) SMGA-20 Carton Carton Wt. Pack lbs. 1 1 9 14 MP-series: 19" rackmount monitor panels PASSIVE: MP-1B: passivemonitorpanelwith12x1selectable(visual/aural)monitoring.Monitorsinput/output(line/speaker)signals. Twelvechannelsaccept speakerlevelinputs(0-100volts).Visualmonitoringviaanalogmeterwith voltagescalerespondingtoselectedspeakerchannel.Auralmonitoring through3"x5"driverorswitchedmonauralheadphoneoutput(stereojack) respondingtospeakerchannelselected.Controlsselectsinglespeaker levelinputfromeachgroupofsixwithabilitytotogglebetweenselected inputs.Rearpanelterminationstobarrierstripscrewterminals,groupselectablefor(70V,25V,and8ohm)speakerlevel.19" x5.5”Dx2Ublack chassis. MP-1B ACTIVE: MP-2: activemonitorpanelwith12x1selectable(visual/aural)monitoring. Monitorsinput/output(line/speaker)signals.Sixchannelsacceptlinelevel inputsignal(-10dBvto+10dBv);6channelsacceptspeakerlevelinputs (0-100volts).VisualmonitoringviaanalogmeterwithVUandvoltagescales respondingtolineorspeakerchannelselected.Auralmonitoringthrough 3"x5"driverorswitchedmonauralheadphoneoutput(stereojack)respondingtolineorspeakerchannelselected.Controlsselectsingleline levelandsinglespeakerlevelwithabilitytotogglebetweenselectedinputs. Rearpanelterminationstobarrierstripscrewterminals;groupselectable for(-10dBvto+10dBv)lineleveland(70V,25V,and8ohm)speakerlevel. 19" x5.5”Dx2Ublackchassis. MP-2 AMPLIFIED: MP-16: amplifiedmonitorpanelwith16channels(visual)and16x1selectable(aural)monitoringthroughlineorspeakerlevelsperchannel.Monitorsinput/output(line/speaker)signals.Eachinputcanbecalibratedto read0VUwithinputsignalfrom100mv(-20dBv)to70V(speakerline) whichaccommodatesCD/DVDplayersto70voltamplifieroutput.Visual monitoringisvia6-position3-colorLEDdisplayswithintegralpeak-hold feature.Auralmonitoringisthrough3"shieldeddriverorswitchedmonaural headphoneoutput(stereojack)drivenbyfullbandwidth10Wamplifier. EachLEDauralchannelsimultaneouslydrivesabalanced600ohmoutput.Intuitivetouchcontrolswitching.Screenoverlayacrosstopfronthas 0.5"HPocket-IDTM labelarea.Rearpanel,phoenix-styleremovableterminalsallowpre-wiringofharnessesandplug-intoMP-16foreasyinstallation and servicing.19"W x 9”D x 2U chassis. Includes UL/CSA-Listed powersupply. Model No. Description MP1B MP2 MP16 Passive AV Monitor Panel (12 speaker input) Active AV Monitor Panel (6 speaker input & 6 line input) Amplified AV Monitor Panel (16 channels) MP-16 Carton Carton Wt. Pack lbs. 1 1 1 8 8 16 TLM: impedance matching transformer XFMR: TLM-600: matchingtransformerisoftenusedinconjunctionwithamaskinggenerator(modelsSMGA5orSMGA20)whenaddingmaskingcapabilitytoanexistingmusic/pagingsystem.(25V-70V-25Kohminto600-150 ohmout). Model No. Description TLM-600 Impedance Matching Transformer Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). TLM-600 Carton Carton Wt. Pack lbs. 1 1 79 AUDIO V: SPEAKERS & COMPONENTS 15" Components Grille for 15" Speaker JG-15: 20" squarescrew-mount,steelgrille.White.FitsbackboxDX1815. JG-15 Model No. Description JG-15 Steel Grille (for 15" speaker) Carton Carton Wt. Pack lbs. 1 9 Backbox for 15" Speaker DX1815: heavygaugesteelbackboxforoptimumacousticperformance of15"speakerinprofessionalsoundreinforcementapplications.Features 4combinationknockouts(0.5"-0.75"),1.5"acousticbattingwithfiberboardtoeliminateresonance,and4(0.25"-20)eyeboltsforflowninstallations.29.5Lx23Wx15D(5.9cu.ft.).Black.FitsgrilleJG-15. Model No. Description DX1815 Steel Acoustic Backbox (fits grille JG-15) DX1815 Carton Carton Wt. Pack lbs. 1 54 12" Components 12" Speaker with Transformer 12E100T60: high-quality,12"coaxialspeaker/transformerpackagethat meetsperformancerequirementsforhigh-poweredcommercialapplicationswithlimitedbudgets.Features1.5"voicecoil,crossover,coaxially mountedhorn-loadedtweeterand100˚sounddispersion.The8ohm, 100Wassemblyincludespre-mounted70Vtransformerwithtapsat7.5, 15,30,and60W. Model No. Description 12E100T60 12" 100W Coaxial Speaker with 60W Transformer 12E100T60 Carton Carton Wt. Pack lbs. 1 14 12" Speaker 12P150: 150Wspeakerforprofessionalapplicationswherehighceilings andhighambientnoiselevelsrequiresspeakerscapableofhighSPLoutput.Features8ohmimpedance,38oz.LFand7.7oz.HFmagnets,large voicecoils,robustcrossoversandacoaxially-mountedhigh-frequency compressiondriver. MadeinU.S.A. 12Q250: 250Wspeakerforprofessionalapplicationswherehighceilings andhighambientnoiselevelsrequirespeakerscapableofhighSPLoutput.Features8ohmimpedance,77oz.LFand42oz.HFmagnets,large voicecoils,robustcrossoversandacoaxially-mountedhigh-frequency compressiondriver.Imported. 80 Model No. Description 12P150 12Q250 12" 150W Coaxial Speaker 12" 250W Coaxial Speaker 12P150 12Q250 Carton Carton Wt. Pack lbs. 1 1 12 28 Screw-mount Grille for 12" Speaker ROUND: RS12-AW: aluminumceilinggrille,16.625"dia.,8screws.Mounts12" speaker(except12Q250)tobackboxCP1210orXCP1210.White. WB-12: steelceilinggrille,17.25"dia.,4screws.Mounts12"speaker(except12Q250)tobackboxCP1210orXCP1210.White. SQUARE: FW-12: steelceilinggrillewithseparatesubplatetosupportthespeaker. 15.25" sq., 4 screws, beveled edges. Mounts 12" speaker (except 12Q250)tobackboxDX1312,DX1512,DX1612,orDX1712.White. FW-12Q: steelceilinggrillewithseparateportedsubplateforimproved speaker performance, 15.25" sq., 4 screws, beveled edges. Mounts speaker12Q250or12P150tobackboxDX1512,DX1612,orDX1712. White. Model No. Description RS12-AW WB-12 FW-12 FW-12Q Round Aluminum Grille (for 12" speaker) white Round Aluminum Grille (for 12" speaker) white Square Steel Grille with subplate (for 12" speaker) white Square Steel Grille with ported subplate (for 12" speaker) white WB-12 RS12-AW FW-12 FW-12Q Carton Carton Wt. Pack lbs. 20 10 6 6 18 25 21 28 Recessed Backbox for 12" Speaker RECTANGULAR: DX1312: (1.9cu.ft.)23"Lx18"Wx8"Dsteelacousticbackboxforprofessional soundreinforcementhas4combinationknockouts(0.5"-0.75"),acousticbatting(1.5"thick,1.5lbs.density),4cornermountingtabs, andfiberboardto eliminateresonance.Black.MountsgrilleFW12orFW12Q.Not recommended for driver 12Q250. DX1512: (2.9cu.ft.)23"Lx18"Wx12"Dsteelacousticbackboxforprofessionalsoundreinforcementhas4combinationknockouts(0.5"-0.75"),acoustic batting(1.5"thick,1.5lbs.density),4cornermountingtabs, andfiberboardto eliminateresonance.Black.MountsgrilleFW12orFW12Q. DX1612: (4cu.ft.)23"Lx18"Wx16.75"Dsteelacousticbackboxforprofessionalsoundreinforcementhas4combinationknockouts(0.5"-0.75"),acoustic batting(1.5"thick,1.5lbs.density),eyebolts(0.25"–20forged), andfiberboard toeliminateresonance.Black.MountsgrilleFW12orFW12Q. DX1712: (5.9cu.ft.)29.5"Lx23"Wx15"Dsteelacousticbackboxforprofessionalsoundreinforcementhas4combinationknockouts(0.5"-0.75"),acoustic batting(1.5"thick,1.5lbs.density),eyebolts(0.25"–20forged), andfiberboard toeliminateresonance.Black.MountsgrilleFW12orFW12Q. ROUND: CP1210: 16.06" dia. x 10.5"D. steel backbox with extended lip features acousticlining(1.5"),knockoutsandmountingbracketwithstudstoinstall transformer(TLM100A)andspeaker(12P150)inplenumswithminimalheight. MountsgrilleRS12AWorWB12.Black. XCP1210: 14.375" dia. x 10.5"D. steel backbox with flat flange features acousticlining(1.5"),knockoutsandmountingbracketwithstudstoinstall transformer(TLM100A)andspeaker(12P150)inplenumswithminimalheight. MountsgrilleRS12AWorWB12.Black. Model No. Description DX1312 DX1512 DX1612 DX1712 CP1210 XCP1210 Recessed Acoustic Backbox (1.9 cu.ft.) Recessed Acoustic Backbox (2.9 cu.ft.) Recessed Acoustic Backbox (4 cu.ft.) Recessed Acoustic Backbox (5.9 cu.ft.) Recessed Backbox (0.9 cu.ft., extended lip) Recessed Backbox (0.9 cu.ft., flat flange) DX1312 DX1512 DX1612 CP1210 Carton Carton Wt. Pack lbs. 1 1 1 1 2 2 28 33 42 55 13 13 Tile Bridge & Support Channels for 12" Speaker TILE BRIDGE: LBS12: 23.75"Lgalvanizedsteeltilebridgewithroundopeningdistributes weight of speaker assembly to ceiling support in suspended ceilings. Mounts12"speakerwithgrilleRS12AWorWB12withoutabackbox. CHANNELS: SS24: 23.75"Lgalvanizedsteelmountingchannelsupports12"speaker withbackboxXCP1210,CP1210,orDX-series.Soldinpairs. SS30: 30"Lgalvanizedsteelmountingchannelsupports12"speakerwith backboxXCP1210,CP1210,orDX-series.Soldinpairs. SS48: 47.75"Lgalvanizedsteelmountingchannelsupports12"speaker withbackboxXCP1210,CP1210,orDX-series.Soldinpairs. LBS12 SS24 Model No. Description Carton Carton Wt. Pack lbs. LBS12 SS24 SS30 SS48 Tile Bridge Mounting Channel Pair (23.75"L) Mounting Channel Pair (30"L) Mounting Channel Pair (47.75"L) 10-ea 25-pr 15-pr 12-pr Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 28 18 24 30 81 8" Components 8" Speaker with Transformer 805-T72 (12W): industry standard dual-cone speaker for basic paging and backgroundmusic.Includesspeaker805(dual-conewith5oz.magnet),0.75" whizzerforimprovedfrequencyresponseandflame-retardantterminalstrips andtransformerTLM572(tapsat0.25,0.5,1,2,5W@70/25V). 810-series (15W): industrystandarddual-conespeakerforbasicpagingor backgroundmusic.Includesspeaker810(dual-conewith10oz.magnet),0.75" whizzer for improved frequency response, flame-retardant terminal strips. Transformervariesbymodel: 810-T72: includesxfmrTLM572(tapsat0.25,0.5,1,2,5W@70/25V) 810-T470: includesxfmrTLM470(tapsat0.5,1,2,4W@70V) 810-T870: includesxfmrTLM870(tapsat1,2,4,8W@70V) 8C10-MRA-T72 (15W): moisture-resistantspeakerforutilitypagingorlow-level backgroundmusicinhighhumidityindoor/outdoorenvironments(lockerroom, greenhouse,etc.).Includesspeakerwith10oz.magnetthat’streatedwithphenolicresinanddoubleacryliclacquercoatingovercottoncone,transformer TLM572(tapsat0.25,0.5,1,2,5W@70/25V),andcorrosion-resistantzincplatedsteelbasket.Whenusedoutdoors,installwhereprotectedfromdirect exposuretosun/rain. 8C10-DVC-2T72 (15W): speakerwith10oz.magnetand2voicecoilsforindustrialandinstitutionalfacilitieswhereindividualspeakersmustbeconnected totwoseparatesystems.Includes2transformers(TLM572withtapsat0.25, 0.5,1,2,5W@70/25V). CT830-series (20W): quality paging and background music. 20W coaxial speakerCT830with10oz.LFand2.1oz.HFmagnets,3-inchpost-mounted tweeterandfirstorderhighpassfilter.Notforusewithtorsiongrilles(unlessIXseriesbackboxisused).Transformervariesbymodel: CT830-T72: includesxfmrTLM572(tapsat0.25,0.5,1,2,5W@70/25V) CT830-T470: includesxfmrTLM470(tapsat0.5,1,2,4W@70V) CT830-T870: includesxfmrTLM870(tapsat1,2,4,8W@70V) CT8320-series (25W): highqualitypagingandbackgroundmusicforcommercialapplicationswithmoderatelyhighceilings(retail,restaurants,etc.).Features 25W coaxial speaker with 18.7 oz. LF and 2.1 oz. HF magnets to provide increasedpowerhandlingandbassresponse.The3-in.post-mountedtweeter provideswidedispersioninhigh-frequencyrange,preventingdullnessinareas betweenspeakerlocations.Notforusewithtorsiongrille(unlessIX-seriesbackboxisused). CT8320-T470: includesxfmrTLM470(tapsat0.5,1,2,4W@70V) CT8320-T870: includesxfmrTLM870(tapsat1,2,4,8W@70V) CT8320-TM1670: includesxfmrTLM1670A(tapsat4,8,16W@70V) 8A50-series (50W): high-performancecoaxialspeaker(8A50)with20oz.LF and2oz.HFmagnetsfor70Vdistributedsoundsystemsprovideseven,high frequencysounddispersionwithlowdistortionandclearfidelityforhighquality foregroundmusic.Featurespost-mounteddometweeter,effectivecrossover, andwooferwithlongexcursion,half-rollsurroundonpolycone.Notforusewith torsiongrille(unlessIX-seriesbackboxisused).Transformervariesbymodel: 8A50-T870: includesxfmrTLM870(tapsat1,2,4,8W@70V) 8A50-TM1670: includesxfmrTLM1670A(tapsat4,8,16W@70V) 8A50-TM3270: includesxfmrTLM3270A(tapsat8,16,32W@70V) 8A50-TS3270: includesxfmrTLS3270(tapsat8,16,32W@70V) 82 805-T72 810-T72 8C10-DVC-2T72 8C10-MRA-T72 CT830-T470 CT8320-T870 CT8320-T470 CT8320-TM1670 8A50-T870 8A50-TM1670 8A50-TM3270 8A50-TS3270 Carton Pack Carton Wt. lbs. Model No. Description 805-T72 810-T72 810-T470 810-T870 8C10MRA-T72 8C10DVC-2T72 CT830-T72 CT830-T470 CT830-T870 CT8320-T470 CT8320-T870 CT8320-TM1670 8" 12W Speaker/Transformer (805 speaker, TLM572 xfmr) 8" 15W Speaker/Transformer (810 speaker, TLM572 xfmr) 8" 15W Speaker/Transformer (810 speaker, TLM470 xfmr) 8" 15W Speaker/Transformer (810 speaker, TLM870 xfmr) 8" 15W Speaker/Transformer (moisture-resistant speaker, TLM572 xfmr) 8" 15W Speaker/Transformer (dual-voice coil speaker, (2) TLM572 xfmrs) 8" 20W Speaker/Transformer (CT830 speaker, TLM572 xfmr) 8" 20W Speaker/Transformer (CT830 speaker, TLM470 xfmr) 8" 20W Speaker/Transformer (CT830 speaker, TLM870 xfmr) 8" 25W Speaker/Transformer (CT8320 speaker, TLM470 xfmr) 8" 25W Speaker/Transformer (CT8320 speaker, TLM870 xfmr) 8" 25W Speaker/Transformer (CT8320 speaker, TLM1670A xfmr) 16 16 16 16 16 16 16 16 16 1 1 4 31 42 47 51 42 55 47 53 58 6 6 26 8A50-T870 8A50-TM1670 8A50-TM3270 8A50-TS3270 8" 50W Speaker/Transformer (8A50 speaker, TLM870 xfmr) 8" 50W Speaker/Transformer (8A50 speaker, TLM1670A xfmr) 8" 50W Speaker/Transformer (8A50 speaker, TLM3270A xfmr) 8" 50W Speaker/Transformer (8A50 speaker, TLS3270 xfmr) 1 1 1 4 6 7 9 44 8" Speaker 805 (12W): dualconespeakerwith5oz.magnet. 810 (15W): dualconespeakerwith10oz.magnet. 8C10MRA (15W): moisture-resistantspeakerwith10oz.magnet 805 810 8C10MRA CT830 CT8320 8A50 CT830 (20W): coaxialspeakerwith10oz.LFand2.1oz.HFmagnets CT8320 (25W): coaxialspeakerwith18.7oz.LFand2.1oz.HFmagnets. 8A50 (50W): coaxialspeakerwith20oz.LFand2oz.HFmagnets 8P100 (100W): coaxialspeakerwith38oz.LFand7.7oz.HFmagnets. Professionallevel,engineeredfordemandingapplicationswherehighceilingsandhighambientnoiserequirearobust,highSPLoutputspeaker. Includeslargevoicecoil,secondandthirdordercrossoverandcompressiondriverhighfrequencyunit.Notforusewithtorsiongrilles. Model No. Description 805 810 8C10MRA CT830 CT8320 8A50 8P100 8" 12W Speaker 8" 15W Speaker 8" 15W Speaker (moisture-resistant) 8" 20W Coaxial Speaker 8" 25W Coaxial Speaker 8" 50W Coaxial Speaker 8" 100W Coaxial Speaker with high-frequency compression driver Carton Pack Carton Wt. lbs. 16 16 16 16 1 4 1 26 38 37 42 5 20 11 8P100 Screw-mount Grille for 8" Speaker ROUND: A8-AW: 12.88"dia.roundaluminumgrille,8screws.White.Mountsto backbox:DX58,DX108,IX810,IX810-EL,RF841,RF871,8XD4,8PSBX, XCP8-seriesandCP8-series. CS-8H: 12.88"dia. roundsteelgrille,4screws.White.Mountstobackbox: DX58,DX108,IX810,IX810-EL,RF841,RF871,8XD4,8PSBX,XCP8-seriesandCP8-series. LO8-P: 12.63"dia.roundgrille,plasticgrid,4screws.White.Mountsto backbox:DX58,DX108,IX810,IX810-EL,RF841,RF871,8XD4,8PSBX, XCP8-seriesandCP8-series. A8-AW CS-8H LO8-P RS8-AW WB-8 WB-8H FW-8 IC-105 JG-8X SG-8 RS8-AW: 12.88"dia.roundaluminumgrille,8screws.White.Mountsto backbox:DX58,DX108,IX810,IX810-EL,RF841,RF871,8XD4,8PSBX, XCP8-seriesandCP8-series. WB-8: roundsteelgrille,12.88"dia.,4screws.White.Mountstobackbox: DX58,DX108,IX810,IX810-EL,RF841,RF871,8XD4,8PSBX,XCP8-seriesandCP8-series. WB-8H: roundsteelgrille,12.88"dia.,8screws.White.Mountstobackbox: DX58, DX108, IX810, IX810-EL, RF841, RF871, 8XD4, 8PSBX, XCP8-seriesandCP8-series. SQUARE: FW-8: 13"sq.steelgrille,4screws,bevelededges.White.Mountsto backboxDX198,P68X-seriesandP875X-series. IC-105: 11.44"sq.steelgrille(roundpunchpattern),8screws.White. MountstobackboxCB84,DX198andP875X-series. JG-8X: 12.38"sq.steelgrille,4screws.White.MountstobackboxCB84, CB88,DX198,P68X-seriesandP875X-series. SG-8: 11.44"sq.steelgrille,4screws.MountstobackboxCB84-SGand P68X-series. Model No. Description A8-AW CS-8H LO8-P RS8-AW WB-8 WB-8H FW-8 IC-105 JG-8X SG-8 Round Aluminum Grille (screw-mount, white) Round Steel Grille (screw-mount, white) Round Plastic Grille (screw-mount, white) Round Aluminum Grille (screw-mount, white) Round Steel Grille (screw-mount, white) Round Steel Grille (screw-mount, white) Square Steel Grille (screw-mount, white) Square Steel Grille (screw-mount, white) Square Steel Grille (screw-mount, white) Square Steel Grille (screw-mount, white) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). Carton Pack Carton Wt. lbs. 20 10 25 10 10 20 10 20 10 10 12 15 17 5 16 24 16 22 29 16 83 Torsion-mount Grille for 8" Speaker ROUND: CN-8M: 12.5"dia.contouredsteel,torsion-mountgrillesupportsspeaker assembliesupto3.5lbs.(unlessusedwithIX-seriesbackbox).Includes2 torsionsprings,mountinghardwareandconcealedspeakerstudsfor“novisiblehardware”appearance.White.MountstobackboxRF8orXCP8series(5-10oz.speaker),orbackboxIX810orIX810-EL(heavierspeaker). CS-8W: 12.88"dia.steel,torsion-mountgrillesupportsspeakerassembliesupto3.5lbs.(unlessusedwithIX-seriesbackbox).Includes2torsion springs,mountinghardwareandconcealedspeakerstudsfor“no-visible hardware”appearance.White.MountstobackboxRF8orXCP8-series(510oz.speaker)orbackboxIX810orIX810-EL(heavierspeaker). WB-8T: 12.88"dia.steel,torsion-mountgrillesupportsspeakerassembliesupto3.5lbs.(unlessusedwithIX-seriesbackbox).Includes2torsion springs,mountinghardwareandconcealedspeakerstudsfor“no-visible hardware”appearance.White.MountstobackboxRF8orXCP8-series(510oz.speaker)orbackboxIX810orIX810-EL(heavierspeaker). SQUARE: CN-8M CS-8W WB-8T FW-8T FW-8T: 13"sq.beveledsteel,torsion-mountgrillesupportsmaximum speaker/transformerweightof3.5lbs.Grilleincludes2torsionspringswith mountinghardwareandconcealedspeakerstudsfor“no-visiblehardware” appearance.White.MountstobackboxRE1175-T. Model No. Description CN-8M CS-8W WB-8T FW-8T Round Contoured Steel Grille (torsion-mount, white) Round Steel Grille (torsion-mount, white) Round Steel Grille (torsion-mount, white) Square Steel Grille (torsion-mount, white) Carton Pack Carton Wt. lbs. 8 10 10 12 18 14 14 26 Tamper-resistant Grille for 8" Speaker SQUARE: SG-8VP: 11.44"sq.steel,tamper-resistantgrillehasasecondarysteel barrierscreentoprotectspeakerfromdamageinvandalism-proneareas. Mountswithtamper-resistant8-32spannerscrews(snakeeyes).White. Orderoptionalspannerscrewdriverseparately.MountsbackboxCB84SGVP,P68X-seriesorUnihorn® LUH-15T. SQLK-8L: 9.5"sq.castaluminum,tamper-resistantgrillehasasecondary steelbarrierscreentoprotectspeakerfromdamage.Mountswithtamperresistant8-32spannerscrews(snakeeyes).White.Orderoptionalspanner screwdriverseparately.MountsbackboxCB84,CB86-4,CB86-6,P875Xseries,orUnihorn® LUH-15T. HARDWARE: SG-8VP HRP832 (spanner head screwdriver). HRP832: spannerscrewdriver withtipforusewith8-32spannerscrews. Model No. Description SG-8VP SQLK-8L HRP832 Square Steel Grille (tamper-resistant, white) Square Cast Aluminum Grille (tamper-resistant, white) Spanner Screwdriver SQLK-8L Carton Pack Carton Wt. lbs. 10 10 1 24 22 1 Surface Baffle for 8" Speaker ROUND: LCB-8: aluminum ceiling or wall baffle with 2 integral grilles for bidirectionalsoundfromsinglespeaker(notincluded).10.75"dia.x4.75"D x12.5”projection.Brushedaluminumfinishwithclearlacquercoating. MadeinUSA. LCB-8 LCS-8NS LCS-8NS: aluminumceilingorwallbafflewithintegralgrille(speakernot included).10.81"dia.x4.69" projection.Brushedaluminumfinishwith clearlacquercoating.MadeinUSA. SQUARE: CEK-8M: steel wall baffle with sloped front (speaker not included). 13.75"Hx10.44"Wx5.75"D.White.MadeinUSA. SL8-W: wood-laminatewallbafflewithslopedfrontandblackclothgrille (speakernotincluded).10.55"Hx9.47"Wx5.5"D.Imported. BSG-8: steelceilingorwallbafflewith2grillesforbi-directionalsound fromsinglespeaker(notincluded).11.57"sq.x4.25"projection.White. MadeinUSA. CEK-8M 84 Model No. Description LCB-8 LCS-8NS CEK-8M SL8-W BSG-8 Bi-directional Baffle (aluminum) Ceiling/Wall Baffle (aluminum) Square Wall Baffle (sloped front, steel, white) Square Wall Baffle (sloped front, wood laminate, black cloth grille) Bi-directional Square Baffle (steel, white) SL8-W Carton Pack Carton Wt. lbs. 6 6 2 2 6 16 16 13 7 36 BSG-8 * Recessed Backbox for 8" Speaker ROUND: CP84: 12"dia.x4.06"Dsteelbackboxwithextendedlipforcutoutinsheetrock orplaster,0.125" acousticfoampad,and4knockouts(0.5"-0.75").Black. Screw-mountfitsgrilles:A8AW,CS8H,LO8P,OM8P,RS8AW,WB8,WB8H. CP87: 12" dia. x 6.69"D steel backbox with extended lip for cutouts in sheetrockorplaster,1.5" acousticbatting,and4knockouts(0.5"-0.75").Black. Screw-mountfitsgrilles:A8AW,CS8H,LO8P,OM8P,RS8AW,WB8,WB8H. CP810: 12"dia.x10.06"D.steelbackboxwithextendedlipforcutoutsin sheetrockorplaster,1.5" acousticbatting,and4knockouts(0.5"-0.75").Black. Screw-mountfitsgrilles:A8AW,CS8H,LO8P,OM8P,RS8AW,WB8,WB8H. CP87 CP84 CP810 XCP84: 10.06"dia.x4.06"Dsteelbackboxwithflatmountingflange,4knockouts(0.5"-0.75")andacousticfoampad(0.125").Black.Screw-mountortorsion-mountfitsgrilles:A8AW,CN8M,CS8H,CS8W,LO8P,OM8P,RS8AW, WB8,WB8H,WB8T. XCP84-S: 10.06"dia.x4.06"Dsteelbackboxwithflatmountingflange,4 knockouts(0.5"-0.75"),acousticfoampad(0.125")andstraps.Black.Screwmountortorsion-mountfitsgrilles:A8AW,CN8M,CS8H,CS8W,LO8P,OM8P, RS8AW,WB8,WB8H,WB8T. XCP87: 10.06"dia.x6.69"Dsteelbackboxwithflatmountingflange,4knockouts(0.5"-0.75")andacousticbatting(1.5").Black.Screw-mountortorsionmountfitsgrilles:A8AW,CN8M,CS8H,CS8W,LO8P,OM8P,RS8AW,WB8, WB8H,WB8T. XCP810: 10.06"dia.x10.06"Dsteelbackboxwithflatmountingflange,4 knockouts(0.5"-0.75")andacousticbatting(1.5").Black.Screw-mountortorsion-mountfitsgrilles:A8AW,CN8M,CS8H,CS8W,LO8P,OM8P,RS8AW, WB8,WB8H,WB8T. 8PSBX:* plasticbackbox.Black.9.88"dia.x4"D.Mountsgrilles:A8AW, CS8H,LO8P,OM8P,RS8AW,WB8,WB8H.Imported. XCP84 XCP87 XCP810 Flange style suits different applications. Flat flange for acoustic tile. Extended lip for sheetrock or plaster. 8XD4: 10"dia.x4"Dstackablesteelbackboxwith4knockouts(0.5"-0.75"), acousticfoampad(0.125").White.Mountsgrille:A8AW,CS8H,LO8P,OM8P, RS8AW,WB8,WB8H. 8XD4-S: sameasabove(8XD4)butincludesstraps. 8XD4-P: 10"dia.x4"Dstackablesteelbackboxwith1rearknockoutand acousticfoampad(0.125").White.Mountsgrille:A8AW,CS8H,LO8P,OM8P, RS8AW,WB8,WB8H. RF841: 10.07"sq.x4.06"Dsteelbackboxforretrofitapplicationshas4-positionadjustabletensionbracketsforpost-constructioninstallationsinceilings ofvaryingdepths.Features4knockouts(0.5"-0.75"),acoustictreatmentand blackfinish.Screw-mountortorsion-mountstylefitsgrilles:A8AWCN8M, CS8H,CS8W,LO8P,OM8P,RS8AW,WB8,WB8H,WB8T. RF871: sameasabove(RF841)butis6.69"D. IX810: 10.63"dia.x10"Dsteelbackbox(flatmountingflange)withinternal mountingplatetodirectlymountspeakerinnewconstructionoracoustictile ceilings.Thedesignallowsheavierspeakerstobeusedwithtorsion-mount grilles.Backboxhas4combinationknockouts(0.5"-0.75"),torsionslotson innerplate,1.5" acousticbatting,andmulti-usetopcoverplatewithsideflanges andholesforseismictie-downorflowninstallation.Includescenter-mount,removable1-gangplatewithmetalconnectorforwireterminationandaccessto transformermountingbracket(suspendedinternallyfromplate).Black.Accepts torsion-mountgrilles:CN8M,CS8W,WB8T,orscrew-mountgrilles:A8AW, CS8H,LO8P,OM8P,RS8AW,WB8,WB8H. IX810-EL: sameasabove(IX810)buthasextendedlip. Model No. Description CP84 CP87 CP810 XCP84 XCP84-S XCP87 XCP810 8PSBX 8XD4 8XD4-P 8XD4-S RF841 RF871 IX810 IX810EL Recessed Round Steel Backbox (extended lip, screw-mount) Recessed Round Steel Backbox (extended lip, screw-mount) Recessed Round Steel Backbox (extended lip, screw-mount) Recessed Round Steel Backbox (screw or torsion-mount) Recessed Round Steel Backbox (screw or torsion-mount with straps) Recessed Round Steel Backbox (screw or torsion-mount) Recessed Round Steel Backbox (screw or torsion-mount) Recessed Round Plastic Backbox (stackable, screw-mount) Recessed Round Steel Backbox (stackable, screw-mount) Recessed Round Steel Backbox (stackable, screw-mount) Recessed Round Steel Backbox (stackable, screw-mount, straps) Recessed Round Retrofit Steel Backbox (screw or torsion-mount) Recessed Round Retrofit Steel Backbox (screw or torsion-mount) Recessed Round Heavy-duty Steel Backbox Recessed Round Heavy-duty Steel Backbox (extended lip) 8XD4 8XD4-P RF841 RF871 8XD4-S 8PSBX * IX810-EL IX810 Carton Pack Carton Wt. lbs. 5 3 2 5 5 3 2 10 10 10 10 5 3 1 1 17 12 10 15 15 13 10 7 17 17 18 15 10 8 8 *Plastic backbox model 8PSBX is imported; all other models are made in the U.S.A. Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 85 Recessed Backbox for 8" Speaker SQUARE: P68X: 10"sq.x4"Dsteelbackboxwith4knockouts(0.5"-0.75")and acoustic foam pad (0.125"). Black. Mounts grilles: FW8, JG8X, SG8, SG8VP. P68X-6: sameasabove(P68X)but6"Dsteelbackbox P875X-4: 8.81"sq.x4"Dsteelbackboxwith4knockouts(0.5"-0.75") andacousticfoampad(0.125").Black.Mountsgrilles:FW8,IC105,JG8X, SQLK8L. P875X-6: sameasabove(P875X-4)but6"Dsteelbackbox. P68X RE1175-T RE1175-T: 11.75"sq.x4"D.steelbackbox,4knockouts(0.5"-0.75"), acousticfoampad(0.125").Black.Mountsgrille:FW8T. LARGE-VOLUME: DX58: round(0.5cu.ft.)12"dia.x8"Dsteelbackboxwithsoundtreatment toeliminateresonanceforprofessionalsoundapplications.Includes4 knockouts(0.5"-0.75"),acousticbatting(1.5"thick,1.5lbs.density).Black. Mountsgrilles:A8AW,CS8H,LO8P,OM8P,RS8AW,WB8,WB8H. P875X-6 DX108: round(1cu.ft.)15"dia.x10.5"Dsteelbackboxwithsoundtreatmenttoeliminateresonanceforprofessionalsoundapplications.Includes 4knockouts(0.5"-0.75")andacousticbatting(1.5"thick,1.5lbs.density). Black.Mountsgrilles:A8AW,CS8H,LO8P,OM8P,RS8AW,WB8,WB8H. DX198: square(1cu.ft.)15"sq.x8"Dsteelbackboxwithfiberboardto eliminateresonanceforprofessionalsoundapplications.Includes4knockouts (0.5"-0.75"), acoustic batting (1.5" thick, 1.5 lbs. density). Black. Mountsgrilles:FW8,IC105,JG8X. DX108 DX58 DX198 Model No. Description P68X P68X-6 P875X-4 P875X-6 RE1175-T DX58 DX108 DX198 Square, Recessed, Steel Backbox (screw-mount) Square, Recessed, Steel Backbox (screw-mount) Square, Recessed, Steel Backbox (screw-mount) Square, Recessed, Steel Backbox (screw-mount) Square, Recessed, Steel Backbox (torsion-mount) Round Recessed, Large-volume, Steel Backbox (screw-mount) Round Recessed, Large-volume, Steel Backbox (screw-mount) Square Recessed, Large-volume, Steel Backbox (screw-mount) Carton Pack Carton Wt. lbs. 5 3 5 3 6 2 2 1 20 16 19 12 39 12 18 20 Surface-mount Backbox for 8" Speaker SQUARE: CB84: 12.31"sq. x 4"D steel backbox with 1.5" acoustic batting. White. Mountsgrilles:IC105,JG8X,SQLK-8L. CB84-SG: 11.5"sq.x4"Dsteelbackboxwith1.5" acousticbatting.White. Mountsgrille:SG8. CB84-SGVP: 11.5"sq.x4"Dsteelbackboxwith1.5" acousticbatting.White. Mountsgrille:SG8VP. CB86-4: 9.63"sq.x4"Dsteelbackboxwith1.5" acousticbatting.White. Mountsgrille:SQLK-8L. CB86-4 CB84-SGVP CB86-6: 9.56"sq.x5.94"Dsteelbackboxwith1.5" acousticbatting.White. Mountsgrille:SQLK-8L. CB88: 12.56"sq.x7.94"Dsteelbackboxwith1.5" acousticbatting.White. Mountsgrille:JG8X. CB88 CB86-6 86 Model No. Description CB84 CB84-SG CB84-SGVP CB86-4 CB86-6 CB88 Square, Surface-mount, Steel Backbox (screw-mount) Square, Surface-mount, Steel Backbox (screw-mount) Square, Surface-mount, Steel Backbox (screw-mount) Square, Surface-mount, Steel Backbox (screw-mount) Square, Surface-mount, Steel Backbox (screw-mount) Square, Surface-mount, Steel Backbox (screw-mount) Carton Pack Carton Wt. lbs. 6 6 6 5 3 3 35 27 39 23 24 22 Tile Bridge & Support Channels for 8" Speaker TILE BRIDGE: LBS8: 23.75"Lgalvanizedsteeltilebridgewithsquareopening.Distributes weightofspeakerassemblytoceilingsupportinsuspendedceilings.Fits thesegrille-backboxcombinations: GRILLE: BACKBOX (if used): A8-AW,CS-8H,LO8-P,OM8-P, RS8-AW,WB-8,WB-8H FW-8,JG-8X IC-105 Series: XCP8,IX810,8XD4 Model: 8PSBX Series: P68X,P875X Series: P875X LBS8 LBS8-R1: 23.75"Lgalvanizedsteeltilebridgewithroundopening.Distributesweightofspeakerassemblytoceilingsupportinsuspendedceilings. Torsion-mount grilles must be used with a backbox. Fits these grille-backboxcombinations: GRILLE: BACKBOX (if used): A8-AW,CS-8H,LO8-P,OM8-P, RS8-AW,WB-8,WB-8H,WB-8-6 CN-8M,CS-8W,WB-8T Series: XCP8,IX810,8XD4,ULXCP8 Model: 8PSBX Series: XCP8,IX810 LBS8-R1 LBS8-CP: 23.75"Ltilebridgewithroundopening.Thistilebridgemust beusedwithabackbox.Fitsthesegrille-backboxcombinations. CHANNELS: GRILLE: BACKBOX (required): A8-AW,CS-8H,LO8-P,OM8-P, RS8-AW,WB-8,WB-8H Series: CP8,DX58,DX108, ULCP8 LBS8-CP SS24: 23.75"Lgalvanizedsteelmountingchannel.Soldinpairs. SS24 SS30: 30"Lgalvanizedsteelmountingchannel.Soldinpairs. SS48: 47.75"Lgalvanizedsteelmountingchannel.Soldinpairs. Model No. Description Carton Pack Carton Wt. lbs. LBS8 LBS8-R1 LBS8-CP SS24 SS30 SS48 Tile Bridge (square opening) Tile Bridge (round opening) Tile Bridge (round opening-must be used with enclosure) Channel Rails (sold in pairs) Channel Rails (sold in pairs) Channel Rails (sold in pairs) 10 10 10 25-pr 15-pr 12-pr 19 17 32 18 24 30 Recessed Mounting Ring for 8" Speaker RINGS: RMP8: 13.81"dia.plasticringforeconomicalinstallationswithinfinitebaffle applications. Check applicable code before use. Mounts grilles: A8AW, CS8H,LO8P,OM8P,RS8AW,WB8,WB8H. PR8-1624: 23.88"Lsteelwith13.25" dia.holeandearsthatspan16"or 24"studs,foreconomicalinstallationswithinfinitebaffleapplications.Check applicablecodebeforeuse.Mountsgrilles:A8AW,CS8H,LO8P,OM8P, RS8AW,WB8,WB8H. HARDWARE: BC-100: extraU-clip8-32hardwareformountingringsorbackboxes. PR8-1624 RMP8 Model No. Description Carton Pack Carton Wt. lbs. RMP8 PR8-1624 BC-100 Plastic Mounting Ring Steel Mounting Ring U-clip hardware (100-piece bag) 50 ea. 10 ea. 1-bag 16 21 1 6" Components 6" Speaker with Transformer 6A40-T870: highperformancecoaxialspeakerwitheven,high-frequencydispersion,lowdistortionandclearfidelityfor70Vdistributedsoundsystem(foregroundmusic).The40Wcoaxialspeakerwith10oz.LFand2oz.HFmagnets, featurespost-mounteddometweeter,effectivecrossover,andwooferwithlong excusion,half-rollsurroundonapolycone.Transformer(TLM870)ismounted totopplateandhastapselectionsat1,2,4,8W(70V).Assemblydepth:5.4". Notforusewithtorsion-mountgrillesunlessIX-seriesbackboxisused. Model No. Description 6A40-T870 6.5" 40W Speaker/Transformer (6A40 speaker, TLM870 xfmr) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 6A40-T870 Carton Pack Carton Wt. lbs. 4 24 87 6" Speaker 6A40: fordistributedsoundsystemsrequiringhighperformancecoaxial speakerswitheven,high-frequencydispersion,lowdistortionandclearfidelity (foregroundmusic).This40Wcoaxialspeakerwith10oz.LFand2oz.HF magnets,featurespost-mounteddometweeter,effectivecrossover,and wooferwithlongexcusion,half-rollsurroundonapolycone.Notforusewith torsion-mountgrillesunlessIX-seriesbackboxisused. Model No. Description 6A40 6.5" 40W Speaker 6A40 Carton Pack Carton Wt. lbs. 4 12 Recessed Backbox for 6" Speaker ROUND: CP87: 12"dia.x6.69"Dsteelbackboxfeatures1.5"acousticbatting,4 combination knockouts (0.5"-0.75"), and extended lip for cutouts in sheetrockorplaster.Blackfinish.AcceptsgrilleWB-8-6. CP810: 12"dia.x10.06"Dsteelbackboxfeatures1.5"acousticbatting, 4combinationknockouts(0.5"-0.75"),andextendedlipforcutoutsin sheetrockorplaster.Blackfinish.AcceptsgrilleWB-8-6. XCP87: 10.06"dia.x6.69"Dsteelbackboxfeatures1.5"acousticbatting, 4combinationknockouts(0.5"-0.75")andflatmountingflange.Blackfinish.AcceptsgrilleWB-8-6. XCP810: 10.06"dia.x10.06"Dsteelbackboxfeatures1.5"acousticbatting,4combinationknockouts(0.5"-0.75")andflatmountingflange.Black finish.AcceptsgrilleWB-8-6. RF871 Flange style suits different applications. Flat flange for acoustic tile. Extended lip for sheetrock or plaster. RF871: 10.07"dia.x6.69"Dsteelbackboxforretrofitapplications,includes4-positionadjustabletensionbracketsforpost-constructioninstallationsinceilingsofvaryingdepths.Features4knockouts(0.5"-0.75"), acoustictreatmentandblackfinish.AcceptsgrilleWB-8-6. IX610: 10.07"dia.x10"Dsteelbackboxwithflatflangeforacoustictile applications and internal speaker mounting plate to directly mount 6" speakerwith8"torsion-mountgrille.Features4combinationknockouts (0.5"-0.75"),torsionslotsoninnerplate,1.5" acousticbatting,andmultiusetopcoverplate.Topplatehassideflangesandholesforseismictiedownorflowninstallation.Includescenter-mount,removable1-gangplate with0.5"Romexconnectorforwireterminationandaccesstotransformer mountingbracket(suspendedinternallyfromplate).Blackfinish.Accepts torsion-mountgrilles:CN8M,CS8W,WB8T.Acceptsscrew-mountgrilles: A8AW,CS8H,LO8P,OM8P,RS8AW,WB8,WB8H. IX610-EL: 10.07" dia.x 10"D steel backbox with extended lip for sheetrock/plasterandinternalspeakermountingplatetodirectlymount 6"speakerwith8"torsion-mountgrille.Features4combinationknockouts (0.5"-0.75"),torsionslotsoninnerplate,1.5" acousticbatting,andmultiusetopcoverplate.Topplatehassideflangesandholesforseismictiedownorflowninstallation.Includescenter-mount,removable1-gangplate with0.5"Romexconnectorforwireterminationandaccesstotransformer mountingbracket(suspendedinternallyfromtheplate).Blackfinish.Acceptstorsion-mountgrilles:CN8M,CS8W,WB8T.Acceptsscrew-mount grilles:A8AW,CS8H,LO8P,OM8P,RS8AW,WB8,WB8H. CP87 CP810 XCP87 XCP810 DX-58 DX-108 DX58: (0.5cu.ft.)12"dia.x8"Dsteelbackboxwithsoundtreatmentto eliminateresonanceforprofessionalsoundapplications.Features4combinationknockouts(0.5"-0.75"),premiumacousticbatting(1.5"thick,1.5 lb. density), extended lip, and 4 flexible hanger straps. Black finish. AcceptsgrilleWB-8-6. DX108: (1cu.ft.)15"dia.x10.5"Dsteelbackboxwithsoundtreatmentto eliminateresonanceforprofessionalsoundapplications.Features4combination knockouts (0.5"-0.75"), premium acoustic batting (1.5" thick, 1.5lb.density),extendedlip,and4flexiblehangerstraps.Blackfinish. AcceptsgrilleWB-8-6. 88 Model No. Description CP87 CP810 XCP87 XCP810 RF871 IX610 IX610-EL DX58 DX108 Steel Backbox (black) Steel Backbox (black) Steel Backbox (black) Steel Backbox (black) Steel Backbox (black) Steel Backbox (flat flange, black) Steel Backbox (extended lip, black) Steel Acoustic Backbox (black) Steel Acoustic Backbox (black) IX610 IX610-EL Carton Pack Carton Wt. lbs. 3 2 3 2 3 2 1 2 2 12 10 13 10 10 12 7 12 18 Screw-mount Grille for 6" Speaker ROUND: WB-8-6: economysteelgrillefor6"speakerassemblyincludes4screws andconcealedspeakermountingstuds.12.88"diameter.Whitefinish. Accepts8"backbox:CP8-series,XCP8-series,DX58,DX108,orRF871. Model No. Description WB-8-6 Steel Grille (screw-mount, white) WB-8-6 Carton Pack Carton Wt. lbs. 10 16 Torsion-mount Grille for 6" Speaker ROUND: CN-8M: 12.5"dia.round,steelgrilleengineeredtocover6" or8" speaker assembly.Includes2torsionspringswithmountinghardwareandconcealedspeakerstudsfor“no-visiblehardware”appearance.Whitepowder epoxyfinish.Forusewithbackbox:IX610orIX610-EL. CS-8W: 12.88"dia.round,steelgrilleengineeredtocover6" or8" speaker assembly.Includes2torsionspringswithmountinghardwareandconcealedspeakerstudsfor“no-visiblehardware”appearance.Whitepowder epoxyfinish.Forusewithbackbox:IX610orIX610-EL. CN-8M CS-8W WB-8T: 12.88"dia.round,steelgrilleengineeredtocover6" or8" speaker assembly.Includes2torsionspringswithmountinghardwareandconcealedspeakerstudsfor“no-visiblehardware”appearance.Whitepowder epoxyfinish.Forusewithbackbox:IX610orIX610-EL. WB-8T Model No. Description CN-8M CS-8W WB-8T Steel Grille (for 6" speaker with IX610 or IX610-EL backbox) torsion-mount, white Steel Grille (for 6" speaker with IX610 or IX610-EL backbox) torsion-mount, white Steel Grille (for 6" speaker with IX610 or IX610-EL backbox) torsion-mount, white Carton Pack Carton Wt. lbs. 8 10 10 18 14 14 Tile Bridge for 6" Speaker LBS8-R1: 23.75"L galvanized steel tile bridge with round opening. Distributesweightofspeakerassemblytoceilingsupportinsuspended ceilings.Torsion-mountgrillesmustbeusedwithabackbox. LBS8-CP: 3.75"Ltilebridgewithroundopening,engineeredtodistribute weight of 6" or 8" speaker assembly to ceiling support in suspended ceilings. Mustbeusedwithabackbox. LBS8-CP LBS8-R1 Model No. Description LBS8-R1 LBS8-CP Tile Bridge (round opening) Tile Bridge (round opening-must be used with enclosure) Carton Pack Carton Wt. lbs. 10 10 17 32 4" Components 4" Speaker with Transformer JR410-series: commercialindustrystandard4"speakerassemblyfor pagingandbackgroundmusicfeatureshigh-compliance,15Wconedriver with10oz.magnetandwiredtransformermountedtotopofbackplate for25Vor70Vdistributedapplications.Threetransformeroptions: TLM572: tapsat0.25,0.5,1,2,5W(25Vor70V) TLM470: tapsat0.5,1,2,4W(70V) TLM870: tapsat1,2,4,8W(70V) 4A30-T870: high-performance4"speakerassemblyfor70Vdistributed soundsystemsrequiringeven,high-frequencydispersion,lowdistortionand clearfidelityforforegroundmusic.Speaker(4A30)isa30Wcoaxialspeaker with10oz.LFand2oz.HFmagnetsfeaturespost-mounteddometweeter, effectivecrossoverandwooferwithlongexcursion,half-rollsurroundona polycone.Transformer(TLM870)hastapsat1,2,4,8W(70V). Model No. Description JR410-T72 JR410-T470 JR410-T870 4A30-T870 4" 15W Speaker/Transformer (JR410 driver, TLM572 xfmr) 4" 15W Speaker/Transformer (JR410 driver, TLM470 xfmr) 4" 15W Speaker/Transformer (JR410 driver, TLM870 xfmr) 4" 30W Speaker/Transformer (4A30 driver, TLM870 xfmr) JR410-T470 JR410-T72 JR410-T870 Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 4A30-T870 Carton Pack Carton Wt. lbs. 8 8 8 6 22 22 24 23 89 4" Speaker JR410: commercial industry standard 4" speaker for high intelligibility paging and background music. Features high-compliance, 15W cone driver with 10 oz. magnet. 8 ohm. 4A30: designed for 70V distributed sound systems requiring a high performance coaxial speaker for even, high-frequency dispersion, low distortion and clear fidelity for foreground music. The 4A30 30W coaxial driver with 10 oz. LF and 2 oz. HF magnets, features post-mounted dome tweeter, effective crossover and woofer with long excursion, half-roll surround on poly cone. 8 ohm. Model No. Description JR410 4A30 4" Speaker 4" Speaker 4A30 JR410 Carton Pack Carton Wt. lbs. 16 6 30 11 Recessed Backbox for 4" Speaker ROUND: CP4: protective steel backbox, 4 combination knockouts (0.5"-0.75"). Black. 6.3" dia. x 4.06"D. For use with screw-mount grille (4 screws). DX104: acoustic steel backbox with 1.5" batting, 4 combination knockouts (0.5"-0.75"). Black. 10" dia. x 6.75"D. For use with screw-mount grille (4 screws). DX104-T: acoustic steel backbox with 1.5" batting, 4 combination knockouts (0.5"-0.75"). Black. 10" dia. x 6.75"D. For use with torsion-mount grille. DX104 CP4 DX104-10T: acoustic steel backbox with 1.5" batting, 4 combination knockouts (0.5"-0.75"). Black. 10" dia. x 10.06"D. For use with torsionmount grille. SQUARE: P625X: protective steel backbox, 4 combination knockouts (0.5"-0.75"). Black. 6.25" square x 4"D. For use with screw-mount grille (4 screws). DX104-10T DX104-T P625X Model No. Description CP4 DX104 DX104-T DX104-10T P625X Round Recessed Steel Backbox (for 4" speaker) black Round Recessed Steel Acoustic Backbox (for 4" speaker) black Round Recessed Steel Acoustic Backbox (for 4" speaker) black Round Recessed Steel Acoustic Backbox (for 4" speaker) black Square Recessed Steel Backbox (for 4" speaker) black Carton Pack Carton Wt. lbs. 12 8 8 4 12 20 32 32 20 26 Surface Backbox for 4" Speaker SQUARE CB44: protective steel backbox with rear mounting holes. 7.125" square x 4.25"D. White. For use with screw-mount grille SG4 (not included). CB44 90 Model No. Description CB44 Square Surface Steel Backbox (for 4" speaker) white Carton Pack Carton Wt. lbs. 12 35 Screw-mount Ceiling Grille for 4" Speaker ROUND: WB-4: 7.25" diameter steel grille includes 4 screws and concealed speaker mounting studs. White. Fits backbox: CP4, DX104. SQUARE: SG-4: 7" square steel grille includes 4 screws and concealed speaker mounting studs. White. Fits backbox: P625X, CB44. WB-4 Model No. Description WB-4 SG-4 Round Steel Grille (for 4" speaker) screw-mount, white Square Steel Grille (for 4" speaker) screw-mount, white SG-4 Carton Pack Carton Wt. lbs. 48 40 32 33 Torsion-mount Grille for 4" Speaker ROUND: CN-4: round, steel grille, 7.63" dia. Fits backbox: DX104-T, DX104-10T. Includes 2 torsion springs and concealed speaker studs for “no-visible hardware” appearance. White. CN-4M: round, steel grille, 8.56 dia. Fits backbox: DX104-T, DX104-10T. Includes 2 torsion springs and concealed speaker studs for “no-visible hardware” appearance. White. WB-4T: round, steel grille, 7.25 dia. Fits backbox: DX104-T, DX104-10T. Includes 2 torsion springs and concealed speaker studs for “no-visible hardware” appearance. White. CN-4M CN-4 WB-4T Model No. Description CN-4 CN-4M WB-4T Round Steel Grille (for 4" speaker) torsion-mount, white Round Steel Grille (for 4" speaker) torsion-mount, white Round Steel Grille (for 4" speaker) torsion-mount, white Carton Pack Carton Wt. lbs. 36 40 48 35 42 32 Tile Bridge & Support Channels for 4" Speaker TILE BRIDGE: LBS4-DX: 23.75"L galvanized steel tile bridge with round opening. Mounts 4" speaker assembly with round backbox (backbox must be used with this model). LBS4-R: 23.75"L galvanized steel tile bridge with round opening. Mounts 4" speaker assembly with round grille WB-4 and no backbox. CHANNELS: LBS4-DX SS24: 23.75"L galvanized steel mounting channels. Sold in pairs (25 pr. per carton). LBS4-R SS24 Model No. Description Carton Pack Carton Wt. lbs. LBS4-DX LBS4-R SS24 Tile Bridge Tile Bridge Support Channel Rails 10-ea 10-ea 25-pr 25 25 18 Recessed Mounting Ring for 4" Speaker PR4: 6.31" diameter steel mounting ring for screw-mount grille WB4. XPR4-T: 6.31" dia. steel mounting ring for torsion-mount grilles. Mounts grille: CN4, CN4M, WB4T. PR4 Model No. Description PR4 XPR4-T Steel Mounting Ring, 6.31" dia., screw-mount Steel Mounting Ring, 6.31" dia., torsion-mount Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). XPR4-T Carton Pack Carton Wt. lbs. 25 25 7 14 91 Transformers 20/20 AudioVision™ XFMR: 20/20 AudioVision: allows speaker to operate at full potential while providing a stable load to the amplifier. In a distributed speaker system, the sound is virtually the same as a transformerless direct-to-voice-coil system. For systems where transformer response under 50Hz with minimal impedance drop is required. TLS-3270: 70V transformer with taps at 8, 16, 32W. 4-8 ohm. TLS10070 TLS3270 TLS-10070: 70V transformer with taps at 16, 32, 64, 100W. 4-8 ohm. Model No. Description TLS3270 TLS10070 AudioVision™ 32W Transformer AudioVision™ 100W Transformer Carton Pack Carton Wt. lbs. 1 4 5 31 Standard XFMR TLM-470: 70V transformer with taps at 0.5, 1, 2, 4W (8 ohm) TLM-825: 25V transformer with taps at 1, 2, 4, 8W (4-8 ohm) TLM-870: 70V transformer with taps at 1, 2, 4, 8W (4-8 ohm) TLM-470 Model No. Description TLM470 TLM870 TLM825 4W Transformer 8W Transformer 8W Transformer TLM-825 TLM-870 Carton Pack Carton Wt. lbs. 6 6 6 7 12 12 High-Performance XFMR: TLM-1670A: 70V transformer with taps at 4, 8, 16W (4-8 ohm) TLM-3270A: 70V transformer with taps at 8, 16, 32W (4-8 ohm) TLM-10070A: 70V transformer with taps at 16, 32, 64, 100W (4-8 ohm) OPTIONS: TMB-1670: mounting bracket for connecting transformer TLM-1670A to 8" speaker. Model No. Description TLM1670A TLM3270A TLM10070A TMB1670 16W Transformer 32W Transformer 100W Transformer Bracket (for TLM1670A xfmr) TLM-1670A TLM-3270A TLM-10070A Carton Pack Carton Wt. lbs. 1 1 1 2 2 3 5 5 Carton Pack Carton Wt. lbs. 24 15 Dual-voltage XFMR: TLM-572: 70V/25V dual-voltage transformer with tap selections at 0.25, 0.5, 1, 2, 5W. 8 ohm. Model No. Description TLM572 Dual-voltage Transformer (70/25V) TLM-572 Impedance-matching XFMR: TLM-600: universal line level impedance matching transformer converts Hi-Z line to balanced 600 ohm line or vice-versa. Attentuates 25V or 70V speaker line to amplifier input. Includes trimpot control for precise level adjustment. RCA jack and screw terminals provided for convenient connection. Model No. Description TLM-600 Impedance Matching Transformer TLM-600 Carton Carton Wt. Pack lbs. 1 1 Hardware Tinnerman Clips BC-100: extra U-clip 8-32 hardware for backboxes and mounting rings. 100-piece bag. 92 Model No. Description Carton Pack Carton Wt. lbs. BC-100 Tinnerman Clips 8-32 (100 pc. bag) 1 bag 1 AUDIO VI: VOLUME CONTROLS Wall-mount Volume Controls Mono: 100/70/25V (1-gang) STANDARD: Single plate volume control mounts in wall box with minimum depth of 2.125”. Features phoenix-style, removable screw termination connector for pre-wire, with capacity for 14-gauge wire. Selection includes 25, 50 or 100W; stainless steel (ss) or plastic plate; 1.5-dB or 3-dB steps, and optional priority relay (PA) for emergency bypass. ETL Listed. DECORA: Two-piece, decora plate mounts in wall box with minimum depth of 2.125.” Features phoenix-style, removable screw termination connector for pre-wire, with capacity for 14-gauge wire. Selection includes 25, 50 or 100W; plastic plate/subplate or stainless steel (ss) with plastic subplate; 1.5-dB or 3-dB steps, and optional priority relay (PA) for emergency bypass. ETL Listed. DECORA with KEY-LOCK: ADAPTER: KL-series: patented** key-lock control has two-piece, decora plate and mounts in standard EO box (1.75"D). Features phoenix-style, removable screw termination connector for pre-wire, with capacity for 14-gauge wire. Selection includes 25, 50 or 100W; plastic plate/subplate or stainless steel (ss) with plastic subplate; 3-dB steps, and optional priority relay (PA) for emergency bypass. ETL Listed. Standard Plastic (white or ivory) Standard Stainless Steel Decora Plastic (black, white, or ivory) Decora Stainless Steel (black or white subplate) Decora (key-lock) Plastic (black, white or ivory) Decora (key-lock) SS (black or white subplate) KL-ANP2: adapter plate allows key-lock controls to be field-installed into 2-gang stainless steel plate. Model No. STANDARD: 25LVC 50LVC 100LVC 10015LVC 100LVC-PA 25LVC-SI 25LVC-SW 50LVC-SI 50LVC-SW 100LVC-SI 100LVC-SW 10015LVC-SI 10015LVC-SW 100LVC-PA-SI 100LVC-PA-SW DECORA: 25LVC-DB 25LVC-DI 25LVC-DW 50LVC-DB 50LVC-DI 50LVC-DW 100LVC-DB 100LVC-DI 100LVC-DW 10015LVC-DB 10015LVC-DI 10015LVC-DW 100LVC-PA-DB 100LVC-PA-DI 100LVC-PA-DW 25LVC-DSB 25LVC-DSW 50LVC-DSB **Patent no. 5,054,076 Carton Pack Carton Wt. lbs. 25W Volume Control (1-gang, 3-dB step, stainless steel) 50W Volume Control (1-gang, 3-dB step, stainless steel) 100W Volume Control (1-gang, 3-dB step, stainless steel) 100W Volume Control (1-gang, 1.5-dB step, stainless steel) 100W Volume Control (1-gang, 3-dB step, priority relay, stainless steel) 25W Volume Control (1-gang, 3-dB step, ivory) 25W Volume Control (1-gang, 3-dB step, white) 50W Volume Control (1-gang, 3-dB step, ivory) 50W Volume Control (1-gang, 3-dB step, white) 100W Volume Control (1-gang, 3-dB step, ivory) 100W Volume Control (1-gang, 3-dB step, white) 100W Volume Control (1-gang, 1.5-dB step, ivory) 100W Volume Control (1-gang, 1.5-dB step, white) 100W Volume Control (1-gang, 3-dB step, priority relay, ivory) 100W Volume Control (1-gang, 3-dB step, priority relay, white) 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 25W Volume Control (1-gang, 3-dB step, Decora black) 25W Volume Control (1-gang, 3-dB step, Decora ivory) 25W Volume Control (1-gang, 3-dB step, Decora white) 50W Volume Control (1-gang, 3-dB step, Decora black) 50W Volume Control (1-gang, 3-dB step, Decora ivory) 50W Volume Control (1-gang, 3-dB step, Decora white) 100W Volume Control (1-gang, 3-dB step, Decora black) 100W Volume Control (1-gang, 3-dB step, Decora ivory) 100W Volume Control (1-gang, 3-dB step, Decora white) 100W Volume Control (1-gang, 1.5-dB step, Decora black) 100W Volume Control (1-gang, 1.5-dB step, Decora ivory) 100W Volume Control (1-gang, 1.5-dB step, Decora white) 100W Volume Control (1-gang, 3-dB step, priority relay, Decora black) 100W Volume Control (1-gang, 3-dB step, priority relay, Decora ivory) 100W Volume Control (1-gang, 3-dB step, priority relay, Decora white) 25W Volume Control (1-gang, 3-dB step, Decora ss/black subplate) 25W Volume Control (1-gang, 3-dB step, Decora ss/white subplate) 50W Volume Control (1-gang, 3-dB step, Decora ss/black subplate) 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Description Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 93 Model No. Carton Pack Description 50LVC-DSW 50W Volume Control (1-gang, 3-dB step, Decora stainless steel/white subplate) 100LVC-DSB 100W Volume Control (1-gang, 3-dB step, Decora stainless steel/black subplate) 100LVC-DSW 100W Volume Control (1-gang, 3-dB step, Decora stainless steel/white subplate) 10015LVC-DSB 100W Volume Control (1-gang, 1.5-dB step, Decora stainless steel/black subplate) 100W Volume Control (1-gang, 1.5-dB step, Decora stainless steel/white subplate) 10015LVC-DSW 100LVC-PA-DSB 100W Volume Control (1-gang, 3-dB step, priority relay, Decora ss/black subplate) 100LVC-PA-DSW 100W Volume Control (1-gang, 3-dB step, priority relay, Decora ss/white subplate) DECORA WITH KEY-LOCK: KL100-DB 100W Volume Control with key lock (1-gang, 3-dB step, Decora black) KL100-DW 100W Volume Control with key lock (1-gang, 3-dB step, Decora white) KL100-DI 100W Volume Control with key lock (1-gang, 3-dB step, Decora ivory) KL100-DSB 100W Volume Control with key lock (1-gang, 3-dB step, Decora ss/black subplate) KL100-DSW 100W Volume Control with key lock (1-gang, 3-dB step, Decora ss/white subplate) KL100-PA-DB 100W Volume Control with key lock (1-gang, 3-dB step, priority relay, Decora black) KL100-PA-DW 100W Volume Control with key lock (1-gang, 3-dB step, priority relay, Decora white) KL100-PA-DI 100W Volume Control with key lock (1-gang, 3-dB step, priority relay, Decora ivory) 100W Volume Control with key lock (1-gang, 3-dB step, priority relay, Decora ss/black) KL100-PA-DSB KL100-PA-DSW 100W Volume Control with key lock (1-gang, 3-dB step, priority relay, Decora ss/white) ADAPTER: KL-ANP2 Adapter Plate (for KL100-series) Carton Wt. lbs. 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 10 2 Mono: 100/70/25V (2-gang) STANDARD: 200LVC: volume control mounts in 2-gang wall box with minimum depth of 2.125" (fits standard 2.5" EO box). Features phoenix-style, removable screw termination connector for pre-wire, with capacity for 14-gauge wire. Stainless steel. DECORA: 200LVC-DSB: volume control (2-piece plate) mounts in 2-gang wall box with minimum depth of 2.125.” Features phoenix-style, removable screw termination connector for pre-wire, with capacity for maximum 14-gauge wire. Stainless steel with black subplate. Model No. Description 200LVC 200LVC-DSB 200W Volume Control (2-gang, 3-dB step, stainless steel) 200W Volume Control (2-gang, 3-dB step, Decora ss/black subplate) 200LVC Carton Pack Carton Wt. lbs. 1 1 2 2 Mono: 1500 ohm L-pad (1-gang) LPD-1500S: 10W volume control provides constant 1500 ohm load to line or power source, regardless of control setting. 1-gang, stainless steel. Model No. Description LPD-1500S 10W Volume Control (L-pad for 1500 constant load, 1-gang, stainless steel) Carton Pack Carton Wt. lbs. 1 1 Mono: 50, 5K, 10K ohm (1-gang) STANDARD: LV-50S: economical 5W volume control with 50 ohm impedance for use in low power circuits—4, 8 or 16 ohm voice coil circuits. 1-gang, stainless steel. LV-5K: economical 5W volume control with 5000 ohm impedance for use in low power circuits—25V, 70V, or 100V constant voltage systems. 1-gang, stainless steel. DECORA: 94 10KLVC-series: 10K ohm linear taper control for single-point remote level adjustment of voltage controlled amplifiers (VCA). Decora plastic or stainless steel (ss) with black or white subplate. Phoenix-style removable screw termination strips for prewire with capacity for 14 gauge wire. 1-gang. Model No. Description LV-50S LV-5K 10KLVC-DB 10KLVC-DW 10KLVC-DI 10KLVC-DSB 10KLVC-DSW 5W Volume Control (50 ohm potentiometer, 1-gang, stainless steel) 5W Volume Control (5K ohm potentiometer, 1-gang, stainless steel) 10K ohm Linear Potentiometer (1-gang, Decora black) 10K ohm Linear Potentiometer (1-gang, Decora white) 10K ohm Linear Potentiometer (1-gang, Decora ivory) 10K ohm Linear Potentiometer (1-gang, Decora ss/black subplate) 10K ohm Linear Potentiometer (1-gang, Decora ss/white subplate) 10KLVC-DSW LV-50S LV-5K Carton Pack Carton Wt. lbs. 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Stereo: 8 ohm (1-gang) STANDARD: Stereo volume control mounts in single-gang EO box with minimum depth of 2.5”. Features phoenix-style, removable screw termination connector for pre-wire, with capacity for 14-gauge wire. 50W per channel with 3-dB steps. Stainless steel (ss) or plastic plate. DECORA: Stereo volume control, decora-style 2-piece plate mounts in single-gang EO box with minimum depth of 2.5”. Features phoenix-style, removable screw termination connector for pre-wire, with capacity for 14-gauge wire. 50W per channel with 3-dB steps. Decora plastic or stainless steel (ss) with plastic subplate. Model No. STANDARD: 50LVCS 50LVCS-SI 50LVCS-SW DECORA: 50LVCS-DB 50LVCS-DW 50LVCS-DI 50LVCS-DSB 50LVCS-DSW Standard Plastic (white or ivory) Standard Stainless Steel Decora Plastic (black, white, or ivory) Decora Stainless Steel (black or white subplate) Carton Pack Carton Wt. lbs. 50W Stereo Volume Control (8 ohm, 1-gang, 3-dB step, stainless steel) 50W Stereo Volume Control (8 ohm, 1-gang, 3-dB step, ivory) 50W Stereo Volume Control (8 ohm, 1-gang, 3-dB step, white) 1 1 1 1 1 1 50W Stereo Volume Control (8 ohm, 1-gang, 3-dB step, Decora black) 50W Stereo Volume Control (8 ohm, 1-gang, 3-dB step, Decora white) 50W Stereo Volume Control (8 ohm, 1-gang, 3-dB step, Decora ivory) 50W Stereo Volume Control (8 ohm, 1-gang, 3-dB step, Decora ss/black subplate) 50W Stereo Volume Control (8 ohm, 1-gang, 3-dB step, Decora ss/white subplate) 1 1 1 1 1 1 1 1 1 1 Description Stereo: 100/70/25V (2-gang) STANDARD: 150LVCS: stereo volume control mounts in 2-gang wall box with minimum depth of 2.5”. Features phoenix-style, removable screw termination connector for pre-wire, with capacity for 14-gauge wire. 150W per channel with 3-dB steps. Stainless steel. DECORA: 150LVCS-DSB: stereo volume control mounts in 2-gang EO box with minimum depth of 2.5". Features phoenix-style, removable screw termination connector for pre-wire, with capacity for 14-gauge wire. 150W per channel with 3-dB steps. Stainless steel with black subplate. 150LVCS-DSB 150LVCS Model No. Description 150LVCS 150LVCS-DSB 150W Stereo Volume Control (70V, 2-gang, 3-dB step, stainless steel) 150W Stereo Volume Control (70V, 2-gang, 3-dB step, Decora ss/black subplate) Carton Pack Carton Wt. lbs. 1 1 2 2 Rackmount Volume Controls Mono: 100/70/25V See Rack Options section of the catalog for rackmount panels with PocketID.™ STANDARD: Rackmount volume control features phoenix-style, removable screw termination connector for pre-wire, with capacity for 14-gauge wire. 3-dB steps. Black adhesive dial scale with knob and mounting hardware. ETL Listed. DECORA: Rackmount volume control (decora-style). Features phoenix-style, removable screw termination connector for pre-wire, with capacity for 14-gauge wire. 3-dB steps. Black (subplate). ETL Listed. Model No. STANDARD: 25LVC-RM 50LVC-RM 100LVC-RM 10015LVC-RM 100LVC-PA-RM 200LVC-RM DECORA: 200LVC-RMDB 50LVC-RM 200LVC-RMDB (Decora) 100LVC-PA-RM Carton Pack Carton Wt. lbs. 25W Rackmount Volume Control (70/25V, 3-dB step, black) 50W Rackmount Volume Control (70/25V, 3-dB step, black) 100W Rackmount Volume Control (70/25V, 3-dB step, black) 100W Rackmount Volume Control (70/25V, 1.5-dB step, black) 100W Rackmount Volume Control (70/25V, 3-dB step, priority relay, black) 200W Rackmount Volume Control (2-gang, 3-dB step) 1 1 1 1 1 1 1 1 1 1 1 2 200W Rackmount Volume Control (2-gang, 3-dB step, Decora black subplate) 1 2 Description Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). 95 Mono: 50, 5K, 10K ohm STANDARD: LV-50S-RM: rackmount volume control (50 ohm) features phoenix-style, removable screw termination connector for pre-wire, with capacity for 14-gauge wire. Black adhesive dial scale with knob, mounting hardware and Pocket-ID™ label area. LV-5K-RM: rackmount volume control (5K ohm) features phoenix-style, removable screw termination connector for pre-wire, with capacity for 14-gauge wire. Black adhesive dial scale with knob, mounting hardware and Pocket-ID™ label area. DECORA: 10KLVC-RM LV-5K-RM 10KLVC-RM: 10K linear taper control for single-point remote level adjustment of voltage controlled amplifiers (VCA). Phoenix-style removable screw termination strips for prewire with capacity for 14 gauge wire. Model No. Description LV-50S-RM LV-5K-RM 10KLVC-RM Rackmount Volume Control (50 ohm potentiometer, 1-gang) Rackmount Volume Control (5K ohm potentiometer, 1-gang) Rackmount Volume Control (10K ohm linear potentiometer VCA, 1-gang) LV-50S-RM Carton Pack Carton Wt. lbs. 6 6 1 2 2 1 Stereo: 100/70/25V STANDARD: 150LVCS-RM: stereo volume control in traditional rackmount assembly that includes control unit with exposed shaft, knob and black adhesive dial scale with Pocket-ID™ label area. Features phoenix-style, removable screw termination connector for pre-wire, with capacity for 4-gauge wire. 150W per channel with 3-dB steps, 2-gang. DECORA: 150LVCS-RMDB: stereo volume control in Decora-style rackmount assembly. Features phoenix-style, removable screw termination connector for pre-wire, with capacity for 14-gauge wire. 150W per channel with 3-dB steps, 2-gang. Black (subplate). 150LVCS-RM Model No. Description 150LVCS-RM 150LVCS-RMDB 150W Rackmount Volume Control (70/25V, 3-dB step, 2-gang, black) 150W Rackmount Volume Control (70/25V, 3-dB step, 2-gang, Decora black) 150LVCS-RMDB Carton Pack Carton Wt. lbs. 1 1 2 2 Stereo: 8 ohm STANDARD: 50LVCS-RM: rackmount stereo volume control provides 3dB per step attenuation of stereo speaker lines. 50W per channel. Adhesive dial scale with Pocket-ID label area. Phoenix-style, plug-in screw termination strips for pre-wire, wire capacity up to 14 ga. Model No. Description 50LVCS-RM 50W Rackmount Stereo Volume Control (8 ohm, 3-dB step, 1-gang, rackmount) 50LVCS-RM Carton Pack Carton Wt. lbs. 1 1 Volume Controls pre-loaded into Rackmount Panels See rack section for complete selection of rackmount panels with PocketID™. The LVC8P-ID-2 panel shown here can be ordered pre-loaded with up to 8 (LVC-series) volume controls. Select the controls you want from the list below and create a custom model number using the letter designations assigned for each control. To create the part number, start with the panel model (LVC8PID-2) then place a letter for each of the 8 volume control positions. Note: volume controls H and I are wide and require 2 spaces (4 max.).** Model No. LVC8P-ID-2 Panel Description Volume Control 8-position Panel (includes assembly) Letter A B C D E F Volume Control Description 25LVC (25W, 3dB step) 50LVC (50W, 3dB step) 100LVC (100W, 3dB step) 100LVC-PA (100W, 3dB step, priority relay) 10015LVC (100W, 1.5dB step) 10KLVC (10K ohm, linear taper control for single-point remote adjustment of voltage controlled amplifiers-VCAs) 50LVCS (50W, 3dB step, stereo, 8ohm) 200LVC (200W, 3dB step, 2-gang) 150LVCS (150W, 3dB step, stereo, 70V, 2-gang) Empty position (hole plug) G H** I** N 96 Note: LVC-series volume controls have phoenix-style removable screw termination strips for pre-wire with capacity for 14-ga. wire. Priority relay models (24VDC @ 5mA ) allow emergency and paging signals to bypass attenuator. 1 2 3 4 5 6 7 8 Panel LVC8P-ID-2 has 8 positions for volume controls. A A A B B E A C Sample Configuration & Model No. LVC8P-ID-2-AAABBEAC AUDIO VII: SOURCE SELECTOR SWITCHES Six-source Program-Selector Switch STANDARD: CS6-SS: stand-alone 6-source program selector switch, stainless steel, 1-gang. DECORA: CS6-DSB: stand-alone 6-source program selector switch, 1-gang. Decora stainless steel with black subplate. CS6-DSW: stand-alone 6-source program selector switch, 1-gang. Decora stainless steel with white subplate. CS6-DB: stand-alone 6-source program selector switch, 1-gang. Decora black. CS6-SS CS6-DSB CS6-DSW CS6-DI CS6-DW CS6-DI: stand-alone 6-source program selector switch, 1-gang. Decora ivory. CS6-DW: stand-alone 6-source program selector switch, 1-gang. Decora white. CS6-DB Model No. Description CS6-SS CS6-DSB CS6-DSW CS6-DB CS6-DI CS6-DW 6-source Program Selector Switch (1-gang, stainless steel) 6-source Program Selector Switch (1-gang, Decora ss/black subplate) 6-source Program Selector Switch (1-gang, Decora ss/white subplate) 6-source Program Selector Switch (1-gang, Decora black) 6-source Program Selector Switch (1-gang, Decora ivory) 6-source Program Selector Switch (1-gang, Decora white) Carton Pack Carton Wt. lbs. 1 1 1 1 1 1 1 1 1 1 1 1 Six-source Program Selector Switch with Volume Control STANDARD: CS650-SS: 50W volume control with 6-source program selector switch, 2-gang. Stainless steel. DECORA: CS650-DSB: 50W volume control with 6-source program selector switch. Decora stainless steel with black subplate. Includes (2) 1-gang and (1) 2-gang cover plates. CS650-DSW: 50W volume control with 6-source program selector switch. Decora stainless steel with white subplate. Includes (2) 1-gang and (1) 2-gang cover plates. CS650-DB: 50W volume control with 6-source program selector switch. Decora black. Includes (2) 1-gang and (1) 2-gang cover plates. CS650-SS CS650-DW CS650-DI: 50W volume control with 6-source program selector switch. Decora ivory. Includes (2) 1-gang and (1) 2-gang cover plates. CS650-DW: 50W volume control with 6-source program selector switch. Decora white. Includes (2) 1-gang and (1) 2-gang cover plates. Decora-style includes (2) 1-gang and (1) 2-gang cover plates. Model No. Description CS650-SS CS650-DSB CS650-DSW CS650-DB CS650-DI CS650-DW 50W Volume Control and 6-source Switch (2-gang, stainless steel) 50W Volume Control and 6-source Switch (1+2-gang plates, Decora ss/black) 50W Volume Control and 6-source Switch (1+2-gang plates, Decora ss/white) 50W Volume Control and 6-source Switch (1+2-gang plates, Decora black) 50W Volume Control and 6-source Switch (1+2-gang plates, Decora ivory) 50W Volume Control and 6-source Switch (1+2-gang plates, Decora white) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). Carton Pack Carton Wt. lbs. 1 1 1 1 1 1 1 1 1 1 1 1 97 AUDIO VIII: MONITOR PANELS Rackmount PASSIVE: MP-1B: passive monitor panel with 12 x 1 selectable (visual/aural) monitoring. Monitors input/output (line/speaker) signals. Twelve channels accept speaker level inputs (0-100 volts). Visual monitoring via analog meter with voltage scale responding to selected speaker channel. Aural monitoring through 3" x 5" driver or switched monaural headphone output (stereo jack) responding to speaker channel selected. Controls select single speaker level input from each group of six with ability to toggle between selected inputs. Rear panel terminations to barrier strip screw terminals, group selectable for (70V, 25V, and 8ohm) speaker level. 19" x 5.5”D x 2U black chassis. ACTIVE: MP-2: active monitor panel with 12 x 1 selectable (visual/aural) monitoring. Monitors input/output (line/speaker) signals. Six channels accept line level input signal (-10dBv to +10dBv); 6 channels accept speaker level inputs (0-100 volts). Visual monitoring via analog meter with VU and voltage scales responding to line or speaker channel selected. Aural monitoring through 3" x 5" driver or switched monaural headphone output (stereo jack) responding to line or speaker channel selected. Controls select single line level and single speaker level with ability to toggle between selected inputs. Rear panel terminations to barrier strip screw terminals; group selectable for (-10dBv to +10dBv) line level and (70V, 25V, and 8ohm) speaker level. 19" x 5.5”D x 2U black chassis. AMPLIFIED: 98 MP-1B MP-2 MP-16: amplified monitor panel with 16 channels (visual) and 16 x 1 selectable (aural) monitoring through line or speaker levels per channel. Monitors input/output (line/speaker) signals. Each input can be calibrated to read 0 VU with input signal from 100mv (-20dBv) to 70V (speaker line) which accommodates CD/DVD players to 70 volt amplifier output. Visual monitoring is via 6-position 3-color LED displays with integral peak-hold feature. Aural monitoring is through 3" shielded driver or switched monaural headphone output (stereo jack) driven by full bandwidth 10W amplifier. Each LED aural channel simultaneously drives a balanced 600 ohm output. Intuitive touch control switching. Screen overlay across top front has 0.5"H PocketIDTM label area. Rear panel, phoenix-style removable terminals allow pre-wiring of harnesses and plug-in to MP-16 for easy installation and servicing.19"W x 9”D x 2U chassis. Includes UL/CSA-Listed power supply. Model No. Description MP1B MP2 MP16 Passive AV Monitor Panel (12 speaker input) Active AV Monitor Panel (6 speaker input & 6 line input) Amplified AV Monitor Panel (16 channels) MP-16 Carton Carton Wt. Pack lbs. 1 1 1 8 8 16 AUDIO IX: ELECTRONIC ACCESSORIES Power Supply General Purpose POWER: PS1224-2: general purpose, heavy duty power supply with 2 amp output is designed for continuous operation wherever a reliable DC power source is required. Includes LED power indicator, slide-switch selectable outputs at 6, 12 and 24V, barrier strip terminals and mounting holes. 7.5"L x 3"W. Model No. Description PS1224-2 Power Supply PS1224-2 Carton Pack Carton Wt. lbs. 1 4 Relay Modules Standard (externally powered) RELAY: RY-2: two (externally powered) dual-pole, dual-throw relays (DPDT) mounted in a compact chassis. Connections are terminated to 3-sided barrier strips for easy field wiring. Independent relay coils include spike protection and polarity diode. 5"L x 3.28"W. RY-4: four (externally powered) dual-pole, dual-throw relays (DPDT) mounted in a compact chassis. Connections are terminated to 3-sided barrier strips for easy field wiring. Independent relay coils include spike protection and polarity diode. 5"L x 6.25"W. Model No. Description RY-2 RY-4 Externally-powered Relay Module (2 DPDT relays) Externally-powered Relay Module (4 DPDT relays) RY-2 RY-4 Carton Pack Carton Wt. lbs. 1 1 1 2 Powered RELAY: RPYS-1A: powered relay module provides the ability to use remotely located, low-voltage switches to power equipment connected to standard high current, high-voltage circuits. This 2-circuit, dual-pole dual-throw (DPDT) relay is activated by a single (SPST) contact closure. It’s ideal for appplications that need to switch multiple independent high current and/or high voltage circuits from a remote location where only low voltage/low current wiring is practical. 5"L x 3.28"W. Model No. Description RYPS-1A Powered Relay Module RYPS-1A Carton Pack Carton Wt. lbs. 1 2 Impedance Matching XFMR: TLM-600: universal line level impedance matching transformer converts Hi-Z line to balanced 600 ohm line or vice-versa. Attenuates 25V or 70V speaker line to amplifier input. Includes trimpot control for precise level adjustment. RCA jack and screw terminals provided for convenient connection. Model No. Description TLM-600 Impedance Matching Transformer Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). TLM-600 Carton Carton Wt. Pack lbs. 1 1 99 AUDIO X: CLOCK / SPEAKER CENTERS Center for Analog Clock (clock / speaker not included) Grille/Frame RECESSED: Grille/frame for speaker center with 8" speaker and industry standard 12" analog clock (speaker, clock and backbox not included). White. 27.25"L x 17"W. AP-300: full-perforation steel grille (fits backbox PC312). BP-300: round-bezel steel grille (fits backbox PC312). SCB-300: square-perforation steel grille (fits backbox PC312). SCB-series AP-series MC-301: round-perforation steel grille (fits backbox PC312). SURFACE: Grille/frame for speaker center with 8" speaker and industry standard 12" analog clock (speaker, clock and backbox not included). White. 26"L x 14.5"W. AP-700: full-perforation steel grille (fits backbox PC712). BP-700: round-bezel steel grille (fits backbox PC712). SCB-700: square-perforation steel grille (fits backbox PC712). MC-701: round-perforation steel grille (fits backbox PC712). Model No. Description AP-300 BP-300 SCB-300 MC-301 AP-700 BP-700 SCB-700 MC-701 Full-perforation Steel Grille/Frame (recessed) Round-bezel Steel Grille/Frame (recessed) Square-perforation Steel Grille/Frame (recessed) Round-perforation Steel Grille/Frame (recessed) Full-perforation Steel Grille/Frame (surface) Round-bezel Steel Grille/Frame (surface) Square-perforation Grille/Frame (surface) Round-perforation Grille/Frame (surface) MC-series BP-series Note: clock, speaker, and backbox are not included with grille/frame. Carton Pack Carton Wt. lbs. 1 1 2 2 2 2 2 2 12 10 13 16 13 14 13 16 Backbox RECESSED: SURFACE: PC312: recessed, steel backbox for speaker center with 8" speaker and industry standard 12" analog clock (speaker, clock and backbox not included). 26"L x 16"W x 3"D. Black. PC712: surface-mount, steel backbox for speaker center with 8" speaker and industry standard 12" analog clock (speaker, clock and backbox not included). 26"L x 14.5"W x 4"D. White. Model No. Description PC312 PC712 Recessed Backbox (for clock/speaker center) Surface-mount Backbox (for clock/speaker center) PC312 PC712 Carton Pack Carton Wt. lbs. 4 3 34 27 Center for Digital Clock (clock / speaker not included) Grille SURFACE: Square, perforated steel grille for use with 8" speaker and digital clock (speaker, clock and backbox not included). 12.89" sq. White. DC802-DD3: fits Dukane 24D20A clock. DC802-DF: fits Faraday 2363-24, Sapling 100, or Sapling 200 clock. DC802-DFR: fits Franklin F1200-6PM clock. DC802-DR1: fits Rauland 2420 clock. DC802-DR2: fits Rauland 2520 clock. DC802-SAP1: fits Sapling 102 or 103-series clock. 100 Model No. Description DC802-DD3 DC802-DF DC802-DFR DC802-DR1 DC802-DR2 DC802-SAP1 Steel Grille (for Dukane 24D20A) Steel Grille (for Faraday 2363-24, Sapling 100, or Sapling 200) Steel Grille (for Franklin F1200-6PM) Steel Grille (for Rauland 2420) Steel Grille (for Rauland 2520) Steel Grille (for Sapling 102 and Sapling 103-series) DC802-series grill (clock, speaker and backbox are not included with grille) Carton Pack Carton Wt. lbs. 10 10 10 10 10 10 21 21 21 21 21 21 Backbox RECESSED: RE1175: steel backbox, 11.75" square x 4"D. Steel backbox for clock/speaker center is designed to accommodate 8" loudspeaker and digital clock. (Loudspeaker, clock and grille are not included.) Fits grille series DC802. SURFACE: SE1275: steel backbox, 12.75" sq. x 4"D. White. Steel backbox for clock/speaker center is designed to accommodate 8" loudspeakers and digital clock. (Loudspeaker, clock and grille are not included.) Fits grille series DC802. Model No. Description RE1175 SE1275 Recessed Steel Backbox (for digital clock/speaker) Surface-mount Steel Backbox (for digital clock/speaker) RE1175 Carton Pack Carton Wt. lbs. 6 6 39 28 Modular Center (clock / speaker not included) Grille/Frame CUSTOM: CTC-series: 18.85"W x 39.13"H heavy gauge steel grille/frame for custom clock-speaker center can be mounted to recessed or surface backbox (order separately). White grille secures to black frame with side lock. To order, select 1 module from each of 5 sections (A-E) and add to core part number below. Note: Clock, handset, speaker, light switch and backbox are not included. Section A Modules: area for clock/strobe includes universal mounting bracket that accommodates most clocks (clock/strobe not included). A1: opening for 12" analog clock A2: openings for 12" analog clock and 1-gang strobe A3: openings for 12" analog clock and 2-gang strobe A4: opening for digital clock Section B Modules: area for handset (not included). B1: blank B2: 1-gang opening B3: locking door Section C Modules: area for speaker (not included). C1: blank C2: studs for 8" speaker (fits Lowell speaker 805, 810, or CT830-series) Section D Modules: area for gang-size electrical device (not included). D1: blank D2: 1 one-gang opening D3: 2 one-gang openings D4: 3 one-gang openings Section E Modules: area for light switch and EO box (not included). E1: blank E2: openings for 1 thermostat and 1 switch E3: openings for 2 switches E4: openings for 3 switches Model No. Sample configuration. Frame has five section modular layout. Clock and other components are not included with grille/frame. Options for: Section A Section B Section C Section D Section E Description Carton Pack CTC-(A_B_C_D_E_)** Modular Grille Frame (for clock/speaker center) 1 **Finish model number by adding individual module numbers for each section (A-E). Example: CTC-A1B2C1D3E2. Price accommodates any module combination. Carton Wt. lbs. 20 Backbox RECESSED: CTC-BXR: 15.6"W x 37"H x 3"D steel backbox for use with modular clock/speaker center (above). White. SURFACE: CTC-BXS: 18.85"W x 39.125"H x 3.06"D steel backbox for use with modular clock/speaker center (above). White. Backbox shown with modular grille/frame (sold separately). Model No. Description CTC-BXR CTC-BXS Recessed Backbox (for modular clock/speaker center) Surface Backbox (for modular clock/speaker center) Weights and measurements are approximate—refer to product specification sheets for complete product information (www.lowellmfg.com). Carton Pack Carton Wt. lbs. 2 2 26.5 20 101 AUDIO XI: WALL & FLOOR BOXES / PLATES Floor BOX: TRIM RING: MO-series: heavy-duty, recessed floor box features internal height adjustment screws for precise positioning. Standard 4" x 4" octagonal box with circular solid brass cover and lid for microphones. MO: floor box with brass lid. MO-1: floor box with brass lid, punched for (1) C3F or C3M. MO-1-C3F: floor box with brass lid, includes (1) C3F connector. MO-3-2D3F: floor box with brass lid, includes (2) D3F connectors. CTR: brass carpet trim ring, 5.16" diameter (for MO-series). Model No. Description MO MO-1 MO-1-C3F MO-3-2D3F CTR Floor Box with Brass Lid Floor Box with Brass Lid, punched for (1) C3F or C3M connector Floor Box with Brass Lid and (1) C3F connector Floor Box with Brass Lid and (2) D3F connectors Carpet Trim Ring CTR Trim Ring installed over MO-series box MO-series Carton Pack Carton Wt. lbs. 6 6 6 1 6 20 20 20 4 2 Wall Wall Box: BOX: Surface-mount, 20 ga. steel enclosure for intercoms, wall plates and devices. Front flanged holes conform to standard wall plate centers and hardware. Rear of box features 0.5" conduit knockouts and mounting holes to install to standard EO box. 2.5"D. P1X: 1-gang box with 4 knockouts P1X-2: 2-gang box with 5 knockouts P1X-3: 3-gang box with 5 knockouts Model No. Description P1X P1X-2 P1X-3 Steel Wall Box (1-gang, 4 knockouts) Steel Wall Box (2-gang, 5 knockouts) Steel Wall Box (3-gang, 5 knockouts) P1X-3 P1X P1X-2 Carton Pack Carton Wt. lbs. 10 10 10 8 10 12 Wall Plate: 1-GANG: 2-GANG: 102 ANP-1: stainless steel wall plate with volume control scale (0-10), 1-gang. MCP13: stainless steel wall plate for (1) D3F, 1-gang. MCP14: stainless steel wall plate with (1) 0.375" hole, 1-gang. A1: blank wall plate, aluminum, 1-gang. S1: blank wall plate, stainless steel, 1-gang. MCP1-C3F: stainless steel wall plate with one C3F connector, 1-gang. MCP1-C3M: stainless steel wall plate with one C3M connector, 1-gang. CS10: single pole single throw (SPST) intercom call switch for general purpose signalling and switching. 1-gang. 0.88"D. ANP-2: stainless steel wall plate with volume control scale (0-10), 2-gang. A2: blank wall plate, aluminum, 2-gang. S2: blank wall plate, stainless steel, 2-gang. MCP2-C3F: stainless steel wall plate with (2) C3F connectors, 2-gang. Model No. Description ANP-1 ANP-2 MCP13 MCP14 A1 A2 S1 S2 MCP1-C3F MCP1-C3M MCP2-C3F CS10 Wall Plate with volume control scale (1-gang, stainless steel) Wall Plate with volume control scale (2-gang, stainless steel) Wall Plate for (1) D3F (1-gang, stainless steel) Wall Plate with (1) hole (1-gang, stainless steel) Blank Wall Plate (1-gang, aluminum) Blank Wall Plate (2-gang, aluminum) Blank Wall Plate (1-gang, stainless steel) Blank Wall Plate (2-gang, stainless steel) Wall Plate with (1) C3F Connector (1-gang, stainless steel) Wall Plate with (1) C3M Connector (1-gang, stainless steel) Wall Plate with (2) C3F Connectors (2-gang, stainless steel) Intercom Call Station (1-gang) ANP-1 MCP1-C3F MCP-13 MCP-14 CS10 ANP2 MCP1-C3M Carton Pack Carton Wt. lbs. 10 10 10 10 10 10 10 10 12 12 6 12 3 3 3 3 2 2 3 3 4 3 4 2 Alpha-numeric Model No. Index Models are identified by series prefix where applicable. New models are displayed in plain text. Old model numbers are shown in italics (with new series prefix listed in parentheses). Note: some products are listed in more than one area of the catalog for convenient access; only the first or primary listing is displayed in this index. Model pg 10015LVC ..............................................93 10015LVC-DB ........................................93 10015LVC-DI ........................................93 10015LVC-DSB......................................94 10015LVC-DSW ....................................94 10015LVC-DW ......................................93 10015LVC-RM ......................................95 10015LVC-SI..........................................93 10015LVC-SW ......................................93 100LVC ..................................................93 100LVC-DB ............................................93 100LVC-DI ............................................93 100LVC-DSB..........................................94 100LVC-DSW ........................................94 100LVC-DW ..........................................93 100LVC-PA ............................................93 100LVC-PA-DB ......................................93 100LVC-PA-DI........................................93 100LVC-PA-DSB....................................94 100LVC-PA-DSW ..................................94 100LVC-PA-DW ....................................93 100LVC-PA-RM......................................95 100LVC-PA-SI........................................93 100LVC-PA-SW ....................................93 100LVC-RM ..........................................95 100LVC-SI..............................................93 100LVC-SW ..........................................93 10KLVC-DB............................................94 10KLVC-DI ............................................94 10KLVC-DSB ........................................94 10KLVC-DSW ........................................94 10KLVC-DW ..........................................94 10KLVC-RM ..........................................96 12E100T60 ............................................80 12P150 ..................................................80 12Q250 ..................................................80 150-LVCS ..............................................95 150LVCS-DSB ......................................95 150LVCS-RM ........................................96 150LVCS-RMDB ....................................96 200LVC ..................................................94 200LVC-DSB..........................................94 200LVC-RM ..........................................95 200LVC-RMDB ......................................95 25LVC ....................................................93 25LVC-DB ..............................................93 25LVC-DI ..............................................93 25LVC-DSB............................................93 25LVC-DSW ..........................................93 25LVC-DW ............................................93 25LVC-RM ............................................95 25LVC-SI................................................93 25LVC-SW ............................................93 4A30 ......................................................90 4A30-T870 ............................................89 50LVC ....................................................93 50LVC-DB ..............................................93 50LVC-DI ..............................................93 50LVC-DSB............................................93 50LVC-DSW ..........................................94 50LVC-DW ............................................93 50LVC-RM ............................................95 50LVC-SI................................................93 50LVC-SW ............................................93 50LVCS..................................................95 50LVCS-DB............................................95 50LVCS-DI ............................................95 50LVCS-DSB ........................................95 50LVCS-DSW ........................................95 50LVCS-DW ..........................................95 50LVCS-RM ..........................................96 50LVCS-SI ............................................95 50LVCS-SW ..........................................95 6A40-T870 ............................................87 805 ........................................................83 Model pg 805-T72..................................................82 810 (speaker) ........................................83 810-series (speaker/xfmr) ......................82 8A50 (speaker) ......................................83 8A50-series (speaker/xfmr)....................82 8C10-DVC-2T72 ....................................82 8C10MRA ..............................................83 8C10MRA-T72 ......................................82 8P100 ....................................................83 8PSBX ..................................................85 8XD4......................................................85 8XD4-P ..................................................85 8XD4-S ..................................................85 A1 ..........................................................102 A2 ..........................................................102 A8-AW....................................................83 AC-GTF20-IG ........................................59 ACB-20-1 ..............................................62 ACLC-100-20-SC248ASM ....................61 ACLC-200-30-SC248ASM ....................61 ACLC-3P-125-30-SC248ASM ..............61 ACLC-3P-225-42-SC248ASM ..............61 ACM-series ............................................57 ACR-1509 ..............................................47 ACR-2009 ..............................................47 ACR-SCS4-1509....................................49 ACR-SCS4-1509K ................................49 ACR-SCS4-2009-RT2............................49 ACR-SCS4-2009K-RT2 ........................49 ACRB-series ..........................................62 ACS-1505-SW ......................................51 ACS-1506 ..............................................51 ACS-1510-RPC......................................53 ACS-1510-WW ......................................51 ACS-1510-WW-SW ..............................51 ACS-1512 ..............................................51 ACS-1512-IEC ......................................51 ACS-1512-IEC-SW ................................51 ACS-1513-WW-HW ..............................52 ACS-1520-IEC-SW ................................51 ACS-1524 ..............................................51 ACS-1524-2C ........................................52 ACS-1524-IEC ......................................51 ACS-1530-IEC ......................................51 ACS-1530-IEC-SW ................................51 ACS-2010-IG-RPC-HW ........................53 ACS-2010-RPC-HW ..............................53 ACS-2012 ..............................................51 ACS-2014-2C-HW ................................52 ACS-2014-HW ......................................52 ACS-2014-IG-2C-HW ............................52 ACS-2014-IG-HW ..................................52 ACS-2014-SS-HW ................................52 ACS-2018-5C-RPC-HW ........................53 ACS-2018-IG-5C-RPC-HW....................53 ACS-2020-10C-HW ..............................52 ACS-2020-6C-HW ................................52 ACS-2020-IG-10C-HW ..........................52 ACS-2020-IG-6C-HW ............................52 ACS-2024 ..............................................51 ACS-2024-2C ........................................52 ACS-MP ................................................51 ACSC-248-ASM ....................................61 ACSE-1012............................................53 ACSE-1012-SW ....................................53 ACSE-1018............................................53 ACSE-1018-SW ....................................53 ACSE-1024............................................53 ACSE-1024-SW ....................................53 ACSP-1502-RPC ..................................58 ACSP-1502-VTE....................................58 ACSP-2002-RPC ..................................58 ACSP-2002-VTE....................................58 ACSP-2004............................................59 ACSP-2004-IG ......................................59 Model pg ACSP-2004-IG-GTF ..............................59 ACSP20-2C ..........................................60 ACSP20-2C-GTF ..................................60 ACSP20-3C ..........................................60 ACSP20-3C-GTF ..................................60 ACSP20-4C ..........................................60 ACSP20-4C-GTF ..................................60 ACSP20-5C ..........................................60 ACSP20-5C-GTF ..................................60 ACSP20-6C ..........................................60 ACSP20-6C-GTF ..................................60 ACSP20M ..............................................60 ACSP20M-GTF......................................60 ACSPR-1509 ........................................47 ACSPR-1509-VTE ................................47 ACSPR-2009 ........................................47 ACSPR-2009-VTE ................................47 ACSPR-RPC1-1509 ..............................48 ACSPR-RPC1-1509K ............................48 ACSPR-RPC1-2009 ..............................48 ACSPR-RPC1-2009K ............................48 ACSPR-SCS4-1509 ..............................49 ACSPR-SCS4-1509K ............................49 ACSPR-SCS4-2009-RT2 ......................49 ACSPR-SCS4-2009K-RT2 ....................49 ACSPS-1502..........................................58 AFP-series ............................................36 ANP-1 ....................................................102 ANP-2 ....................................................102 AP-300 ..................................................100 AP-700 (clock/speaker center) ..............100 AP-series (aluminum panels) ................36 BC-100 ..................................................92 BC-810-72..............................................72 BP-300 ..................................................100 BP-700 ..................................................100 BSG-8 ....................................................84 C1830-870 ............................................76 C3S........................................................43 C3SL......................................................43 CB44......................................................90 CB84......................................................86 CB84-SG................................................86 CB84-SGVP ..........................................86 CB86-4 ..................................................86 CB86-6 ..................................................86 CB88......................................................86 CEK-8M ................................................84 CLB-32 (CMV2-18) ................................45 CLB-77 (CMV2-44) ................................45 CMBS-series..........................................44 CMC-series............................................44 CMCD-series ........................................44 CMD-2V ................................................45 CMD-series............................................44 CMFW-series ........................................44 CMHT-series..........................................44 CMPS-series..........................................44 CMR-series............................................44 CMV2-series ..........................................45 CMV3-series ..........................................45 CMV5-series ..........................................45 CN-4 ......................................................91 CN-4M....................................................91 CN-8M....................................................84 CN-series (speakers) ............................70 COMPAC™............................................58 CP1210..................................................81 CP4........................................................90 CP810....................................................85 CP84......................................................85 CP87......................................................85 CS-8H ....................................................83 CS-8W ..................................................84 CS6-series ............................................97 Model pg CS650-series ........................................97 CT830 (speaker)....................................83 CT830-series (speaker/xfmr) ................82 CT8320 (speaker)..................................83 CT8320-series (speaker/xfmr) ..............82 CTC-series ............................................101 CTR........................................................102 D1410-72 ..............................................76 D3410-72 ..............................................76 D3P-ID-1................................................38 D3P-ID-2................................................38 D4P-1 ....................................................38 D6410-72 ..............................................76 D8P-ID-3................................................38 D9P-ID-3................................................38 DBB-4 ....................................................38 DC802-series ........................................100 DSL-810-72............................................71 DSQ-810-72 ..........................................71 DX104....................................................90 DX104-10T ............................................90 DX104-T ................................................90 DX108....................................................86 DX1312..................................................81 DX1512..................................................81 DX1612..................................................81 DX1712..................................................81 DX1815..................................................80 DX198....................................................86 DX58......................................................86 FS18-series............................................26 FT1-7 ....................................................46 FTC-1 ....................................................46 FW-12 ..................................................81 FW-12Q ................................................81 FW-8 ....................................................83 FW-8T ..................................................84 FW-FF....................................................46 FW1-KIT ................................................46 FW2-3 ....................................................46 FW2-RD ................................................46 FW3-3 ....................................................46 FW4-7 ....................................................46 FWS-215 (shelf) ....................................42 GBB-series ............................................34 GT-series (LGT) ....................................35 HRP832 ................................................73 IC-105 ....................................................83 IM-series / iMount™ ..............................66 IMC-series / iMount™Cylinder ..............67 IP-ID-1....................................................38 IX610......................................................88 IX610-EL................................................88 IX810......................................................85 IX810EL ................................................85 JG-15 ....................................................80 JG-8X ....................................................83 JR410 ....................................................90 JR410-T470 ..........................................89 JR410-T72 ............................................89 JR410-T870 ..........................................89 KDMS ....................................................42 KDMSL ..................................................42 KL-ANP2................................................94 KL100-series..........................................94 KOP ......................................................35 KOP-N....................................................35 L1-series (AFP)......................................36 L10-series (USVC) ................................39 L15-3X (VDX-2-2032) ............................41 L15-series (US)......................................39 L15-series with -E suffix (USE) ..............39 L16-3 (FWS-215) ..................................41 L18-series (disc., see new models) ......42 L184 ......................................................48 103 Model 104 pg L184-TVSS ............................................48 L191A (C3S) ..........................................43 L192A (C3SL) ........................................43 L195 (LL)................................................43 L2-series (AP)........................................36 L20-series (SBL)....................................42 L203 (LK-FD) ........................................43 L204 (LK-RD) ........................................43 L21-1910 (MH-6-VHS) ..........................42 L212-series (RRD) ................................35 L2150-series (LFD)................................32 L2160-series (LRD)................................33 L22-197 (MH-4-CD) ..............................42 L250-series with -LD suffix (LWR)..........25 L253-series with -LD suffix (LWR)..........25 L258-series (LPR)..................................22 L259-series (LPR)..................................22 L260-series (LER-F) ..............................08 L260-series with -S suffix (LSER-F) ......16 L262-series (LER-F) ..............................08 L262-series with -S suffix (LSER-F) ......16 L265-series (LER)..................................06 L265-series with -S suffix (LSER) ..........14 L267-series (LER)..................................06 L267-series with -S suffix (LSER) ..........14 L268-series (LER)..................................06 L268-series with -S suffix (LSER) ..........14 L275-77CR (LCCR) ..............................34 L275-series (LGR) ................................10 L275-series with -S suffix (LSGR)..........18 L277-77CR (LCCR) ..............................34 L277-series (LGR) ................................10 L277-series with -S suffix (LSGR)..........18 L278-77CR (LCCR) ..............................34 L278-series (LGR) ................................10 L278-series with -S suffix (LSGR)..........18 L279-77CR (LCCR) ..............................34 L279-series (LGR) ................................10 L279-series with -S suffix (LSGR)..........18 L28-series (disc. see new models) ........42 L280-series (LRR)..................................12 L29K (KDMS) ........................................41 L29KL (KDMSL) ....................................41 L3-series (SP)........................................36 L35-1912 (FT1-7) ..................................46 L39 (FW-FF) ..........................................46 L40-series (LDSR) ................................31 L45-series (LPSR-F) ..............................23 L46-series (LDDF) ................................33 L5-series (SVP)......................................37 L55-series (disc., see new LWR-F)........26 L6-series (SVSP) ..................................37 L70-series (disc., see new LDR)............31 L83-series (LWTCR) ..............................27 L87-series (LWTR) ................................27 L9-series (SSC) ....................................37 LBS12 ....................................................81 LBS4-DX................................................91 LBS4-R ..................................................91 LBS8 ......................................................87 LBS8-CP................................................87 LBS8-CP................................................89 LBS8-R1 ................................................87 LBS8-R1 ................................................89 LCB-8 ....................................................84 LCC4-series ..........................................34 LCM-1 (CMC-1HV) ................................44 LCM-1V (CMCD-1HV) ..........................44 LCMD-1H (CMD-1H)..............................44 LCMD-1HV (CMD-1HV) ........................44 LCMD-2H (CMD-2H)..............................44 LCMD-2HV (CMD-2HV) ........................44 LCMP (CMBS) ......................................44 LCR-1216 ..............................................30 LCR-21 (LCR-1216) ..............................30 LCS-8NS................................................84 LD3-RMP (D3P-ID-1) ............................38 LD3-RMP2 (D3P-ID-2) ..........................38 LD4-RM (D4P-1) ....................................38 LD8-RMP (D8P-ID-3) ............................38 LD9-RMP (D9P-ID-3) ............................38 LDDF-series ..........................................33 LDR-series ............................................31 LDSR-series ..........................................31 Model pg LE-series (SEP) ....................................36 LEF-series (SEFP) ................................36 LER-F-series..........................................08 LER-series ............................................06 LFD-series ............................................32 LGR-series ............................................10 LGRB-12................................................45 LGT-series ............................................35 LH-series................................................72 LHR-series ............................................29 LK-FD ....................................................43 LK-RD ....................................................43 LL ..........................................................43 LLR-series..............................................12 LMB-series ............................................34 LMSB-series ..........................................34 LN10-RMP (N10P-ID-1) ........................38 LO8-P ....................................................83 LPD-1500S ............................................94 LPID-RMP (IP-ID-1) ..............................38 LPPR-2432 ............................................23 LPR-42 (LPPR-2432) ............................23 LPR-series ............................................22 LPSR-F-series ......................................23 LPT2-series (LPTR) ..............................28 LPT4-series (LPTR) ..............................28 LPTR-series ..........................................28 LR-RRK-series (LLR-RRT) ....................12 LR1018-B (LLR) ....................................12 LR1218-B (LLR) ....................................12 LR1618-B (LLR) ....................................12 LR2118-B (LLR) ....................................12 LRD-series ............................................33 LRR-series ............................................12 LSB-series ............................................34 LSER-F-series ......................................16 LSER-series ..........................................14 LSG6-RM (SG6P-3) ..............................38 LSGR-series ..........................................18 LSSB-series ..........................................34 LT-series: music/paging ........................69 LT-series: pro ........................................68 LT-series: sound-masking ......................77 LTC-1 (FTC-1)........................................46 LUH-series ............................................73 LV-50S ..................................................94 LV-50S-RM ............................................96 LV-5K ....................................................94 LV-5K-RM ..............................................96 LVC-RMP (LVC8P-ID-2) ........................38 LVC8P-ID-2 (modular) ..........................39 LVR-series ............................................20 LWBR-series ..........................................24 LWF-1912 (FW4-7) ................................46 LWF-195-2 (FW2-3) ..............................46 LWF-195-3 (FW3-3) ..............................46 LWF-KIT (FW1-KIT) ..............................46 LWF-RD-2 (FW2-RD) ............................46 LWR-F-series ........................................26 LWR-series ............................................25 LWS-116 (RSD-116) ..............................41 LWTCR-series........................................27 LWTR-series ..........................................27 LWX-series (VWS) ................................41 MB-series (LMB)....................................34 MBS-series (LMSB) ..............................34 MC-301 ..................................................100 MC-701 ..................................................100 MCP1-C3F ............................................102 MCP1-C3M ............................................102 MCP13 ..................................................102 MCP14 ..................................................102 MCP2-C3F ............................................102 MDX-series ............................................67 MH-4-CD ..............................................42 MH-6-VHS..............................................42 MO ........................................................102 MO-1......................................................102 MO-1-C3F..............................................102 MO-3-2D3F............................................102 MP16......................................................79 MP1B ....................................................79 MP2........................................................79 MSM ......................................................64 Model pg N10P-ID-1..............................................38 OS-series ..............................................71 P1X ........................................................102 P1X-2 ....................................................102 P1X-3 ....................................................102 P625X ....................................................90 P68X ......................................................86 P68X-6 ..................................................86 P875X-4 ................................................86 P875X-6 ................................................86 PB-series (LSB) ....................................34 PBS-series (LSSB) ................................34 PC-312 ..................................................100 PC-712 ..................................................100 POWERSTAC™ ....................................54 PR4........................................................91 PR8-1624 ..............................................87 PRK........................................................21 PS1224-2 ..............................................99 PTB-12 (LGRB-12) ................................45 R1805-series..........................................76 R1810-series..........................................76 R7810-72 ..............................................76 R7810-72K ............................................76 R7810-series..........................................76 RC-100 ..................................................43 RCN-series ............................................43 RE1175 ..................................................101 RE1175-T ..............................................86 RF841 ....................................................85 RF871 ....................................................85 RGH-series ............................................43 RL-series................................................43 RMK-series ............................................40 RMP8 ....................................................87 RPAK-81072 ..........................................70 RPC-1-series ........................................63 RPC-4CD ..............................................48 RPC-4MC ..............................................48 RPSB-series ..........................................64 RPSW-KEY............................................64 RRD-series ............................................35 RRT-series ............................................35 RRTMB-F ..............................................26 RS-series ..............................................43 RS12-AW ..............................................81 RS8-AW ................................................83 RSD-116 ................................................41 RSP-series ............................................43 RSR-series ............................................43 RSV-series ............................................43 RT-1810-72 ............................................76 RY-2 ......................................................99 RY-4 ......................................................99 RYPS-1A................................................99 S1 ..........................................................102 S2 ..........................................................102 SBL-series ............................................42 SCB-300 ................................................100 SCB-700 ................................................100 SCS-4R..................................................50 SCS-4RK ..............................................50 SCS-series ............................................63 SCS8R-ASM..........................................50 SCS8RK-ASM........................................50 SE1275 ..................................................101 SEFP-series ..........................................36 SEP-series ............................................36 SG-4 ......................................................91 SG-8 ......................................................83 SG-8VP..................................................84 SG6P-3 ..................................................38 SL-series................................................72 SL8-W....................................................84 SM-series ..............................................78 SMG-series............................................78 SMGA-20 ..............................................79 SMGA-5 ................................................79 SMLT-series (SMTGM) ..........................77 SMTGM-series ......................................77 SP-series ..............................................36 SQLK-8L ................................................84 SS24 ......................................................81 SS30 ......................................................87 Model pg SS48 ......................................................87 SSC-series ............................................37 SVP-series ............................................37 SVSP-series ..........................................37 TLK ........................................................43 TLM10070A ..........................................92 TLM1670A ............................................92 TLM3270A ............................................92 TLM470..................................................92 TLM572..................................................92 TLM600..................................................92 TLM825..................................................92 TLM870..................................................92 TLS10070 ..............................................92 TLS3270 ................................................92 TMB1670 ..............................................92 U181RL..................................................47 U181RL-LC............................................47 UDE ......................................................42 UDEL ....................................................42 UDP ......................................................42 UL-CB44 ................................................74 UL-CB84-SG..........................................74 UL-CP4 ..................................................74 UL-CP84 ................................................74 UL-DX104 ..............................................75 UL-DX104T............................................75 UL-P625X ..............................................74 UL-P68X ................................................74 UL-XCP84-S ..........................................74 UL-XCP87..............................................75 ULD-series ............................................74 ULS-series ............................................74 ULT-series..............................................74 ULXCP1210-TM100 ..............................75 UNIHORN® ............................................73 US-series ..............................................39 USE-series ............................................39 USVC-series ..........................................39 VARI-RACK® ..........................................20 VCW-12 ................................................45 VDS-2-2032 ..........................................41 VWS-series............................................41 WB-12....................................................81 WB-4......................................................91 WB-4T....................................................91 WB-8......................................................83 WB-8-6 ..................................................89 WB-8H ..................................................83 WB-8T....................................................84 WB-8T....................................................89 WB12-12P150........................................75 WB4-4A30-T870 ....................................75 WB4T-4A30-T870 ..................................75 WB8-8A50-T870 ....................................75 WS21-17................................................26 X-series..................................................30 XCP1210................................................81 XCP810..................................................85 XCP84....................................................85 XCP84-S................................................85 XCP87....................................................85 XCP87....................................................88 XPR4-T ..................................................91